# Primara Labs: full text > The full text of every product page, Research Desk page, tool and answer page on https://www.primaralabs.com, one page per section, each with its URL and last-updated date. The short index is https://www.primaralabs.com/llms.txt. Every page is also available as markdown at its path plus .md. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Pages: 109. --- URL: https://www.primaralabs.com/marketplace/retatrutide Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/retatrutide.md # Retatrutide 15mg, Philippines Retatrutide is an investigational peptide acting at the GLP-1, GIP and glucagon receptors, in Phase 3 trials for obesity and approved nowhere. Primara Labs stocks it in Metro Manila as a 15mg research vial at ₱3,325, or ₱2,990 with the standing 10% off, with same-day metro delivery. Research use only. Triple agonist at the GLP-1, GIP and glucagon receptors. Studied in Phase 2 obesity trials. 10% off every order, applied in chat. Presentation Lyophilized powder, 15 mg / vial Catalogue code PRM-001 ## Buy by the pack Swipe, up to 50% off Single vial ₱2,990₱3,325 per vial Single vial, ₱2,990 total 1 vial, 15mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱2,228 per vial 5 vials, ₱11,140 total 5 vials, 75mg total 5 x 3ml water · 50 syringes · 50 pads Free courier at this total, anywhere in the Philippines. Best value 10 pack · 50% off list ₱1,663 per vial 10 vials, ₱16,630 total 10 vials, 150mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. Retatrutide. FDA Philippines: not established. US FDA: Investigational. Sponsor plans a US Biologics License Application submission in Q1 2027. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order Retatrutide on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20Retatrutide%2015mg%20(%E2%82%B12%2C990).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/retatrutide). - Stocked in Metro Manila, same-day before 12 noon - Batch number on every vial - Cold-chain packed, insulated to the door - 10% off every order, applied in chat Retatrutide batch RETA-4728-A is Janoshik-tested for bacterial endotoxin: 6.066 EU per vial, analysed 21 September 2026 (task 234146, key H2KI86I8GWB4). This report covers bacterial endotoxin only. It does not establish identity or purity. Reports covering identity, amount and purity are published at primaralabs.com/coa per batch as they are issued. - [Retatrutide · Bacterial endotoxin · RETA-4728-A · September 2026](https://www.primaralabs.com/coa#retatrutide-reta-4728-a) · [Reading an endotoxin result](https://www.primaralabs.com/coa#endotoxin) [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Phase 3 human](https://www.primaralabs.com/research/evidence#retatrutide) FDA Philippines [Not published](https://www.primaralabs.com/research/status#retatrutide) Latest batch report [Janoshik, bacterial endotoxin, batch RETA-4728-A, September 2026](https://www.primaralabs.com/batch/reta-4728-a) Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/shape?ref=pl) Overview ## Retatrutide in the Philippines Retatrutide is an investigational single peptide with agonist activity at three receptors: GLP-1, GIP and glucagon. Semaglutide acts at GLP-1 alone and tirzepatide at GLP-1 and GIP; the glucagon receptor is what retatrutide adds, and in trial populations it is studied for raised energy expenditure alongside the appetite and glycaemic signalling the other two receptors carry. It is in Phase 3 and approved nowhere. TRIUMPH-1, a phase 3 trial in adults with obesity, or overweight with at least one weight-related condition, without diabetes (Lilly investor release, 2026), reported 28.3% mean weight reduction at 80 weeks on the 12mg arm, rising to 30.3% at 104 weeks in the extension cohort. The trial evidence, with the adverse events beside it, is set out below. Primara Labs stocks retatrutide as a 15mg lyophilized vial, held in cold storage inside Metro Manila. Because inventory is already in the country there is no international shipping leg, no customs exposure and no multi-week wait. Verified orders placed before noon dispatch the same day across Metro Manila, with courier delivery reaches Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. Every vial ships in insulated cold-chain packaging with the batch number printed on the label, so orders are traceable to their production lot. Pricing is transparent and in pesos: ₱3,325 per vial, or ₱2,990 with the standing 10% off. Retatrutide remains an investigational compound. It is not FDA approved, and everything sold on this page is supplied strictly for laboratory research use. It is not for human consumption, and Primara Labs does not provide medical advice, dosing guidance for people or clinical support. Each 15mg vial arrives as a dry powder in insulated packaging. Put it in the fridge at 2 to 8°C, away from light, as soon as it lands. To order, tap the WhatsApp button on this page: the chat opens with the vial and pack size already typed, and the reply confirms stock, the peso total and a delivery slot. Orders confirmed before 12 noon get same-day Metro Manila delivery. For the trial history in one place, read the [Retatrutide guide](https://www.philippinespeptides.com/peptides/retatrutide) on philippinespeptides.com. ### Research focus - Mechanism: single-peptide activity at the GLP-1, GIP and glucagon receptors. Glucagon receptor agonism is the differentiator under study against semaglutide (GLP-1 only) and tirzepatide (GLP-1 plus GIP). - Phase 3 TRIUMPH-1 (n=2,339, Lilly investor release, 2026): 19% at 4mg, 25.9% at 9mg and 28.3% at 12mg at 80 weeks against 2.2% on placebo, with the 12mg arm reaching 30.3% at 104 weeks in the extension cohort. - Phase 2 (Jastreboff et al., N Engl J Med 2023; n=338, 48 weeks): dose-dependent, 8.7% at 1mg, 17.1% at 4mg, 22.8% at 8mg and 24.2% at 12mg, against 2.1% on placebo. - TRIUMPH-2 (n=1,152, 80 weeks) enrolled adults with type 2 diabetes and obesity or overweight and reported 20.8% at 12mg. TRIUMPH-3 (n=1,949) enrolled adults with severe obesity (BMI of 35 or more) and established cardiovascular disease, with or without type 2 diabetes and reported 22.6%. TRIUMPH-OUTCOMES (cardiovascular and renal outcomes, approximately 10,000 participants) has not read out. - Body composition (Lancet Diabetes Endocrinol 2025, DXA substudy of the type 2 diabetes Phase 2 trial, n=189, 36 weeks): total fat mass fell 4.9% at 0.5mg, 15.2% at 4mg, 26.1% at 8mg and 23.2% at 12mg, against 4.5% on placebo and 2.6% on dulaglutide. The proportion of lean mass loss to weight loss was similar to other obesity treatments. ## Benefits studied 1. #### Body-weight reduction Phase 3 human In TRIUMPH-1, a phase 3 trial in adults with obesity, or overweight with at least one weight-related condition, without diabetes (n=2,339), mean body weight fell 28.3% on the 12 mg arm over 80 weeks, against 2.2% lost on placebo (efficacy estimand). [Eli Lilly topline release, 21 May 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss) · checked 23 September 2026 2. #### Blood sugar control Phase 3 human In TRIUMPH-2, a phase 3 trial in adults with type 2 diabetes and obesity or overweight lasting 80 weeks, a1C fell 1.4, 1.6 and 1.5 points from a baseline of 7.7% on 4, 9 and 12 mg, against 0.2 on placebo. [Eli Lilly topline release, 23 July 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 3. #### Body-weight reduction with type 2 diabetes Phase 3 human In TRIUMPH-2, a phase 3 trial in adults with type 2 diabetes and obesity or overweight (n=1,152), mean body weight fell 20.8% on the 12 mg arm over 80 weeks, against 4.0% lost on placebo (efficacy estimand). [Eli Lilly topline release, 23 July 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 4. #### Body-weight reduction with cardiovascular disease Phase 3 human In TRIUMPH-3, a phase 3 trial in adults with severe obesity (BMI of 35 or more) and established cardiovascular disease, with or without type 2 diabetes (n=1,949), mean body weight fell 22.6% on the 12 mg arm over 80 weeks, against 3.2% lost on placebo (efficacy estimand). [Eli Lilly topline release, 23 July 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 5. #### Knee osteoarthritis pain Phase 3 human In TRIUMPH-4, a phase 3 trial in adults with obesity or overweight and knee osteoarthritis, without diabetes lasting 68 weeks, WOMAC pain fell 4.5 and 4.4 points from a baseline of 6.0 on 9 and 12 mg, against 2.4 on placebo. [Eli Lilly topline release, 11 December 2025](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-weight-loss-average) · checked 23 September 2026 ## Side effects reported In TRIUMPH-1, discontinuation because of adverse events was 4.1% on 4 mg, 6.9% on 9 mg and 11.3% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were nausea in 28.6% on 4 mg, 38.4% on 9 mg and 42.4% on 12 mg against 14.8% on placebo, diarrhoea in 25.2% on 4 mg, 34.1% on 9 mg and 32.0% on 12 mg against 13.5% on placebo, constipation in 23.8% on 4 mg, 25.9% on 9 mg and 26.1% on 12 mg against 10.9% on placebo and vomiting in 10.6% on 4 mg, 22.8% on 9 mg and 25.3% on 12 mg against 4.8% on placebo. [Eli Lilly topline release, 21 May 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss) · checked 23 September 2026 In TRIUMPH-4, discontinuation because of adverse events was 12.2% on 9 mg and 18.2% on 12 mg, against 4.0% on placebo. The most frequently reported adverse events were nausea in 38.1% on 9 mg and 43.2% on 12 mg against 10.7% on placebo, diarrhoea in 34.7% on 9 mg and 33.1% on 12 mg against 13.4% on placebo, constipation in 21.8% on 9 mg and 25.0% on 12 mg against 8.7% on placebo and vomiting in 20.4% on 9 mg and 20.9% on 12 mg against 0.0% on placebo. [Eli Lilly topline release, 11 December 2025](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-weight-loss-average) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works Retatrutide is a single peptide that activates three receptors: GIP, GLP-1 and glucagon. Lilly describes it as a first-in-class triple hormone receptor agonist. Targets: GIP, GLP-1 and glucagon receptors [Source](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 Research ## What the research shows Retatrutide has four completed phase 3 trials, TRIUMPH-1 to TRIUMPH-4, reported by Eli Lilly between December 2025 and July 2026, and a phase 2 trial published in 2023. It is studied for obesity and overweight with a weight-related condition, type 2 diabetes, knee osteoarthritis pain, obstructive sleep apnoea, chronic low back pain, cardiovascular and renal outcomes, and fatty liver disease (MASLD). Further phase 3 trials are running, including TRIUMPH-5 against tirzepatide. [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) In TRIUMPH-1, a phase 3 trial of retatrutide in adults with obesity, or overweight with at least one weight-related condition, without diabetes (n=2,339), mean body weight fell 19.0% on 4 mg, 25.9% on 9 mg and 28.3% on 12 mg over 80 weeks, against 2.2% on placebo (efficacy estimand; Eli Lilly topline release, 21 May 2026). In TRIUMPH-1, discontinuation because of adverse events was 4.1% on 4 mg, 6.9% on 9 mg and 11.3% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were nausea in 28.6% on 4 mg, 38.4% on 9 mg and 42.4% on 12 mg against 14.8% on placebo, diarrhoea in 25.2% on 4 mg, 34.1% on 9 mg and 32.0% on 12 mg against 13.5% on placebo, constipation in 23.8% on 4 mg, 25.9% on 9 mg and 26.1% on 12 mg against 10.9% on placebo and vomiting in 10.6% on 4 mg, 22.8% on 9 mg and 25.3% on 12 mg against 4.8% on placebo. [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) In TRIUMPH-2, a phase 3 trial of retatrutide in adults with type 2 diabetes and obesity or overweight (n=1,152), mean body weight fell 12.7% on 4 mg, 19.1% on 9 mg and 20.8% on 12 mg over 80 weeks, against 4.0% on placebo (efficacy estimand; Eli Lilly topline release, 23 July 2026). In TRIUMPH-2, discontinuation because of adverse events was 3.8% on 4 mg, 11.6% on 9 mg and 7.7% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were diarrhoea in 27.4% on 4 mg, 33.5% on 9 mg and 33.6% on 12 mg against 13.2% on placebo, nausea in 13.7% on 4 mg, 20.8% on 9 mg and 28.0% on 12 mg against 8.0% on placebo, constipation in 14.0% on 4 mg, 16.2% on 9 mg and 16.8% on 12 mg against 9.4% on placebo and decreased appetite in 5.8% on 4 mg, 12.3% on 9 mg and 17.1% on 12 mg against 4.5% on placebo. [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) In TRIUMPH-3, a phase 3 trial of retatrutide in adults with severe obesity (BMI of 35 or more) and established cardiovascular disease, with or without type 2 diabetes (n=1,949), mean body weight fell 21.6% on 9 mg and 22.6% on 12 mg over 80 weeks, against 3.2% on placebo (efficacy estimand; Eli Lilly topline release, 23 July 2026). In TRIUMPH-3, discontinuation because of adverse events was 9.8% on 9 mg and 13.5% on 12 mg, against 4.8% on placebo. The most frequently reported adverse events were diarrhoea in 30.1% on 9 mg and 24.4% on 12 mg against 8.7% on placebo, nausea in 21.7% on 9 mg and 22.4% on 12 mg against 5.8% on placebo, constipation in 18.0% on 9 mg and 15.7% on 12 mg against 7.1% on placebo and decreased appetite in 13.5% on 9 mg and 14.5% on 12 mg against 3.0% on placebo. [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) In TRIUMPH-4, a phase 3 trial of retatrutide in adults with obesity or overweight and knee osteoarthritis, without diabetes (n=445), mean body weight fell 26.4% on 9 mg and 28.7% on 12 mg over 68 weeks, against 2.1% on placebo (efficacy estimand; Eli Lilly topline release, 11 December 2025). In TRIUMPH-4, discontinuation because of adverse events was 12.2% on 9 mg and 18.2% on 12 mg, against 4.0% on placebo. The most frequently reported adverse events were nausea in 38.1% on 9 mg and 43.2% on 12 mg against 10.7% on placebo, diarrhoea in 34.7% on 9 mg and 33.1% on 12 mg against 13.4% on placebo, constipation in 21.8% on 9 mg and 25.0% on 12 mg against 8.7% on placebo and vomiting in 20.4% on 9 mg and 20.9% on 12 mg against 0.0% on placebo. [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) In Retatrutide phase 2 (Jastreboff), a phase 2 trial of retatrutide in adults with a BMI of 30 or more, or 27 to under 30 with at least one weight-related condition (n=338), mean body weight fell 8.7% on 1 mg, 17.1% on 4 mg (pooled), 22.8% on 8 mg (pooled) and 24.2% on 12 mg over 48 weeks, against 2.1% on placebo (Jastreboff AM et al. N Engl J Med 2023;389:514-526). Retatrutide phase 2 (Jastreboff): The abstract reports gastrointestinal events as the most common, dose-related and mostly mild to moderate, without rates; rates by arm are in the full text, not read here. Specification ## Compound specification | Compound class | Peptide triple hormone receptor agonist | | Targets or pathway | GIP, GLP-1 and glucagon receptors | | Sequence | Not published | | Molecular formula | Not published | | Molecular weight | Not published | | CAS number | Not published | | PubChem CID | Not published | | Form | Lyophilised powder | | Vial size | 15mg | PubChem holds no compound record under the name retatrutide (checked 23 September 2026), and the originating paper is not open access, so formula, weight, CAS and sequence are not published here. Local market, 25 August 2026 ## Retatrutide prices in the Philippines, per milligram | Seller | Vial | Price | Per mg | | --- | --- | --- | --- | | Noxa Labs | 20mg | ₱3,849 | ₱192 | | Primara Labsthis page | 15mg | ₱2,990 | ₱199 | | Noxa Labs | 10mg | ₱2,999 | ₱300 | | Baseline Labs | 5mg | ₱2,359 | ₱472 | Primara stocks retatrutide as a 15mg vial at ₱2,990, ₱199 per milligram. Noxa's 20mg vial is ₱192 per milligram, roughly 4% below us, and it is the cheapest per milligram in this table. We are not going to bury that. What we hold against it is a lower entry price, a pack ladder that is cheaper per milligram at every tier, and a vial that arrives ready to reconstitute. Competitor figures were read off each seller's own product page on 25 August 2026 and are a dated snapshot. The [full retatrutide price comparison](https://www.primaralabs.com/buy/retatrutide-philippines) carries every pack tier, and the [retatrutide price in the Philippines](https://www.primaralabs.com/blog/retatrutide-price-philippines) post covers how the market has moved. Stock sits in Metro Manila, so [same-day Metro Manila delivery](https://www.primaralabs.com/delivery) applies to every figure here, and [what we do and do not claim](https://www.primaralabs.com/trust) sets out the rest. For the research background rather than the price, there is a [retatrutide guide for the Philippines](https://www.philippinespeptides.com/guides/retatrutide-philippines-2026) on our editorial partner's site. Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 1.0 ml | 15 mg/ml | Highest concentration, smallest volumes | | 2.0 ml | 7.5 mg/ml | Common reference dilution | | 3.0 ml | 5 mg/ml | Larger volumes, finer graduation | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for Retatrutide 15mg](https://www.primaralabs.com/calculator?c=retatrutide) Deeper read: [Retatrutide price in the Philippines (2026)](https://www.primaralabs.com/blog/retatrutide-price-philippines) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## Retatrutide batch reports - [Retatrutide · Bacterial endotoxin · RETA-4728-A · September 2026](https://www.primaralabs.com/batch/reta-4728-a) · [Reading an endotoxin result](https://www.primaralabs.com/coa#endotoxin) Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA Investigational Eli Lilly's release of 23 July 2026 describes retatrutide as investigational. Drugs@FDA returned no approved application. [Source](https://lilly.mediaroom.com/2026-07-23-Lillys-triple-agonist,-retatrutide,-successful-in-two-additional-Phase-3-obesity-trials,-delivering-significant-improvements-in-weight-and-A1C) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Sponsor plans a US Biologics License Application submission in Q1 2027 Eli Lilly press release dated 23 July 2026. [Source](https://lilly.mediaroom.com/2026-07-23-Lillys-triple-agonist,-retatrutide,-successful-in-two-additional-Phase-3-obesity-trials,-delivering-significant-improvements-in-weight-and-A1C) · checked 23 September 2026 [Retatrutide on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#retatrutide) Frequently asked ## Retatrutide questions, answered ### What is retatrutide and what does it cost in the Philippines? Retatrutide is an investigational peptide acting at the GLP-1, GIP and glucagon receptors, in Phase 3 trials for obesity and approved nowhere. Primara Labs stocks it in Metro Manila as a 15mg research vial at ₱3,325, or ₱2,990 with the standing 10% off, with same-day metro delivery. Research use only. ### How much weight did participants lose in TRIUMPH-1? TRIUMPH-1, a phase 3 trial in adults with obesity, or overweight with at least one weight-related condition, without diabetes (n=2,339), is the pivotal obesity study. Over 80 weeks, mean body weight fell 19% at 4mg, 25.9% at 9mg and 28.3% at 12mg, against 2.2% on placebo (efficacy estimand, Lilly topline release, May 2026). In a pre-specified extension of 532 participants with a baseline BMI of 35 or more who completed the 80-week study, the 12mg arm reached 30.3% at 104 weeks. ### How much does retatrutide cost in the Philippines? Primara Labs supplies retatrutide 15mg vials at ₱3,325, or ₱2,990 with the standing 10% off. Stock is held inside the Philippines, so there are no import fees, customs risk or international shipping costs on top. ### Is retatrutide in stock and how fast is delivery? Retatrutide 15mg is in stock. Verified orders placed before noon dispatch the same day across Metro Manila. Provincial orders ship by insulated courier and reach Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### Is retatrutide legal in the Philippines? Retatrutide is an investigational compound, not a controlled substance in the Philippines. It is supplied strictly as a research chemical for laboratory use and is not FDA approved for human use. ### How is retatrutide reconstituted for research use? The lyophilized powder is reconstituted with bacteriostatic water. Adding 2.0 ml to a 15mg vial yields a 7.5 mg/ml reference concentration. Reconstituted material should be refrigerated and used within 28 days. ### How does local stock change delivery compared to importing? Ordering from overseas suppliers means customs screening at NAIA, cold-chain risk over a 1 to 3 week transit and no recourse if a package is held. Primara Labs vials are already inside the Philippines, so Metro Manila orders arrive the same day and provincial orders within days, in insulated packaging the whole way. ### How do I order retatrutide from Primara Labs? Ordering runs through WhatsApp. Tap the order button on this page and the chat opens with your vial pre-filled. Confirm quantity and delivery details in the conversation and payment instructions follow there. ### Is Primara the cheapest retatrutide in the Philippines? Not always on a single vial. Some sellers list smaller vials at a lower sticker. At the 10-pack tier the per-milligram price is among the lowest locally listed, and the vial is already in Manila rather than in transit. The comparison table above shows every named seller. ### Do you give dosing guidance? No. Retatrutide is supplied for laboratory research only. Primara Labs does not advise on human dosing, titration or administration, on this page or in chat. The reconstitution reference above covers concentration only. ### What does the batch number on the vial mean? Each vial carries the production lot it came from. If you message us with the batch number we can tell you when that lot was received and how it was stored. ### Can clinics or resellers buy retatrutide in volume? Yes. Terms are set per account over WhatsApp rather than published. The wholesale page explains the three programmes. ### What is Retatrutide studied for? Retatrutide has four completed phase 3 trials, TRIUMPH-1 to TRIUMPH-4, reported by Eli Lilly between December 2025 and July 2026, and a phase 2 trial published in 2023. It is studied for obesity and overweight with a weight-related condition, type 2 diabetes, knee osteoarthritis pain, obstructive sleep apnoea, chronic low back pain, cardiovascular and renal outcomes, and fatty liver disease (MASLD). Further phase 3 trials are running, including TRIUMPH-5 against tirzepatide. ### What side effects were reported for Retatrutide? In TRIUMPH-1, discontinuation because of adverse events was 4.1% on 4 mg, 6.9% on 9 mg and 11.3% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were nausea in 28.6% on 4 mg, 38.4% on 9 mg and 42.4% on 12 mg against 14.8% on placebo, diarrhoea in 25.2% on 4 mg, 34.1% on 9 mg and 32.0% on 12 mg against 13.5% on placebo, constipation in 23.8% on 4 mg, 25.9% on 9 mg and 26.1% on 12 mg against 10.9% on placebo and vomiting in 10.6% on 4 mg, 22.8% on 9 mg and 25.3% on 12 mg against 4.8% on placebo. In TRIUMPH-4, discontinuation because of adverse events was 12.2% on 9 mg and 18.2% on 12 mg, against 4.0% on placebo. The most frequently reported adverse events were nausea in 38.1% on 9 mg and 43.2% on 12 mg against 10.7% on placebo, diarrhoea in 34.7% on 9 mg and 33.1% on 12 mg against 13.4% on placebo, constipation in 21.8% on 9 mg and 25.0% on 12 mg against 8.7% on placebo and vomiting in 20.4% on 9 mg and 20.9% on 12 mg against 0.0% on placebo. ### Is Retatrutide approved in the Philippines? Retatrutide. FDA Philippines: not established. US FDA: Investigational. Sponsor plans a US Biologics License Application submission in Q1 2027. Checked 23 September 2026. ### How should Retatrutide be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for Retatrutide? Retatrutide batch RETA-4728-A is Janoshik-tested for bacterial endotoxin: 6.066 EU per vial, analysed 21 September 2026 (task 234146, key H2KI86I8GWB4). This report covers bacterial endotoxin only. It does not establish identity or purity. Reports covering identity, amount and purity are published at primaralabs.com/coa per batch as they are issued. Related compounds [PRM-006 Tirzepatide 15mg ₱1,890](https://www.primaralabs.com/marketplace/tirzepatide-15mg)[PRM-018 Semaglutide 15mg ₱1,990](https://www.primaralabs.com/marketplace/semaglutide-15mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about Retatrutide, answered - [Is retatrutide approved in the Philippines?](https://www.primaralabs.com/answers/is-retatrutide-approved-in-the-philippines) - [When will retatrutide be approved?](https://www.primaralabs.com/answers/when-will-retatrutide-be-approved) - [How does retatrutide work?](https://www.primaralabs.com/answers/how-does-retatrutide-work) - [What did the retatrutide trials find?](https://www.primaralabs.com/answers/what-did-retatrutide-trials-find) - [What are the side effects of retatrutide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-retatrutide) Research Desk ## Retatrutide on the Research Desk - [Evidence Map: Retatrutide (Phase 3 human)](https://www.primaralabs.com/research/evidence#retatrutide) - [Trial: TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [Trial: TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [Trial: TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [Trial: TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [Trial: Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [Regulatory status: Retatrutide](https://www.primaralabs.com/research/status#retatrutide) - [Batch RETA-4728-A](https://www.primaralabs.com/batch/reta-4728-a) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/tirzepatide-15mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/tirzepatide-15mg.md # Tirzepatide 15mg, Philippines Dual GIP and GLP-1 receptor agonist with an extensive published trial record. 10% off every order, applied in chat. Presentation Lyophilized powder, 15 mg / vial Catalogue code PRM-006 ## Buy by the pack Swipe, up to 50% off Single vial ₱1,890₱2,100 per vial Single vial, ₱1,890 total 1 vial, 15mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱1,407 per vial 5 vials, ₱7,035 total 5 vials, 75mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱1,050 per vial 10 vials, ₱10,500 total 10 vials, 150mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. Tirzepatide. FDA Philippines: not established. US FDA: Approved for glycemic control in type 2 diabetes mellitus (Mounjaro); weight reduction in obesity or overweight with a comorbidity and moderate to severe obstructive sleep apnea in adults with obesity (Zepbound). Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order Tirzepatide on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20Tirzepatide%2015mg%20(%E2%82%B11%2C890).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/tirzepatide). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Phase 3 human](https://www.primaralabs.com/research/evidence#tirzepatide) FDA Philippines [Not published](https://www.primaralabs.com/research/status#tirzepatide) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Overview ## Tirzepatide in the Philippines Tirzepatide is a dual agonist of the GLP-1 and GIP receptors, the compound behind the Mounjaro and Zepbound brands. In the SURMOUNT-1 trial it produced 22.5% mean weight reduction over 72 weeks, and it remains the benchmark against which newer incretin compounds are measured. Primara Labs stocks tirzepatide as a 15mg lyophilized vial at ₱2,100, or ₱1,890 with the standing 10% off. Local suppliers generally list tirzepatide in vials from 15mg up to 60mg, so this is the same presentation most of the market sells, at a lower total. Vials are in stock, dispatching same day across Metro Manila on orders verified before noon. Tirzepatide is not supplied for human use. It is a research compound for laboratory work only. Tirzepatide acts at two receptors, GLP-1 and GIP. Retatrutide adds a third, the glucagon receptor, and sits one stage behind in development: tirzepatide is an approved medicine in several markets under its brand names, while retatrutide is in Phase 3 and approved nowhere. Both are held in the same Metro Manila cold storage for researchers who [buy retatrutide Philippines](https://www.primaralabs.com/marketplace/retatrutide) stock alongside this vial. Tirzepatide ships as a freeze-dried 15mg vial. Keep it sealed and refrigerated until the day it is used in the lab. Ordering takes one message: the WhatsApp button fills in the product and pack, and we answer with the total and the delivery time. Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. Provincial parcels reach Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. How the compound was developed and studied is covered in the [Tirzepatide guide](https://www.philippinespeptides.com/peptides/tirzepatide). ### Research focus - SURMOUNT-1 (NEJM 2022): 22.5% mean weight reduction at 72 weeks in the 15mg arm. - Dual incretin mechanism studied for improved GI tolerability versus single GLP-1 agonism. - SURMOUNT-5 compared tirzepatide with semaglutide head to head in adults with obesity, with percentage change in body weight as the primary endpoint. ## Benefits studied 1. #### Body-weight reduction Phase 3 human In SURMOUNT-1, a phase 3 trial in adults with BMI of 30 or more, or 27 or more with at least one weight-related complication, excluding diabetes (n=2,539), mean body weight fell 20.9% on the 15 mg arm over 72 weeks, against 3.1% lost on placebo (treatment-regimen estimand). [Jastreboff AM et al. N Engl J Med 2022;387:205-216](https://doi.org/10.1056/NEJMoa2206038) · checked 23 September 2026 2. #### Body-weight reduction with type 2 diabetes Phase 3 human In SURMOUNT-2, a phase 3 trial in adults (18 or older) with BMI of 27 kg/m2 or higher and type 2 diabetes with HbA1c 7-10% (53-86 mmol/mol), in seven countries (n=938), mean body weight fell 14.7% on the 15 mg arm over 72 weeks, against 3.2% lost on placebo (treatment-regimen estimand). [Garvey WT et al. Lancet 2023 (SURMOUNT-2)](https://doi.org/10.1016/s0140-6736(23)01200-x) · checked 23 September 2026 3. #### Maintenance of weight reduction Phase 3 human In SURMOUNT-4, a phase 3 withdrawal trial (n=670), participants who continued tirzepatide after a 36-week lead-in lost a further 5.5% by week 88, while those switched to placebo regained 14.0%. [Aronne LJ et al. JAMA 2024 (SURMOUNT-4)](https://doi.org/10.1001/jama.2023.24945) · checked 23 September 2026 4. #### Body-weight reduction against semaglutide Phase 3 human In SURMOUNT-5, a phase 3b head-to-head trial in adults with obesity but without type 2 diabetes (n=751), mean body weight fell 20.2% on tirzepatide against 13.7% on semaglutide over 72 weeks. [Aronne LJ et al. N Engl J Med 2025 (SURMOUNT-5)](https://doi.org/10.1056/NEJMoa2416394) · checked 23 September 2026 ## Side effects reported In SURMOUNT-1, discontinuation because of adverse events was 4.3% on 5 mg, 7.1% on 10 mg and 6.2% on 15 mg, against 2.6% on placebo. [Jastreboff AM et al. N Engl J Med 2022;387:205-216](https://doi.org/10.1056/NEJMoa2206038) · checked 23 September 2026 In SURMOUNT-3, discontinuation because of adverse events was 10.5% on maximum tolerated dose (10 or 15 mg), against 2.1% on placebo. The most frequently reported adverse events were nausea in 39.7% on maximum tolerated dose (10 or 15 mg) against 14.0% on placebo, diarrhoea in 31.0% on maximum tolerated dose (10 or 15 mg) against 9.2% on placebo, constipation in 23.0% on maximum tolerated dose (10 or 15 mg) against 6.8% on placebo and vomiting in 18.1% on maximum tolerated dose (10 or 15 mg) against 1.4% on placebo. [Wadden TA et al. Nat Med 2023 (SURMOUNT-3)](https://doi.org/10.1038/s41591-023-02597-w) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works Tirzepatide is a single peptide that activates two receptors: GIP (glucose-dependent insulinotropic polypeptide) and GLP-1. Targets: GIP and GLP-1 receptors [Source](https://doi.org/10.1056/NEJMoa2206038) · checked 23 September 2026 Research ## What the research shows Tirzepatide has five completed phase 3 obesity trials in the Research Desk dataset, SURMOUNT-1 to SURMOUNT-5, published between 2022 and 2025. SURMOUNT-5 compared it head to head with semaglutide in adults with obesity without type 2 diabetes. Its wider trial record, including its diabetes programme, is larger than this dataset holds. [SURMOUNT-1](https://www.primaralabs.com/research/trials/surmount-1) In SURMOUNT-1, a phase 3 trial of tirzepatide in adults with BMI of 30 or more, or 27 or more with at least one weight-related complication, excluding diabetes (n=2,539), mean body weight fell 15.0% on 5 mg, 19.5% on 10 mg and 20.9% on 15 mg over 72 weeks, against 3.1% on placebo (treatment-regimen estimand; Jastreboff AM et al. N Engl J Med 2022;387:205-216). In SURMOUNT-1, discontinuation because of adverse events was 4.3% on 5 mg, 7.1% on 10 mg and 6.2% on 15 mg, against 2.6% on placebo. [SURMOUNT-2](https://www.primaralabs.com/research/trials/surmount-2) In SURMOUNT-2, a phase 3 trial of tirzepatide in adults (18 or older) with BMI of 27 kg/m2 or higher and type 2 diabetes with HbA1c 7-10% (53-86 mmol/mol), in seven countries (n=938), mean body weight fell 12.8% on 10 mg and 14.7% on 15 mg over 72 weeks, against 3.2% on placebo (treatment-regimen estimand; Garvey WT et al. Lancet 2023 (SURMOUNT-2)). SURMOUNT-2: The abstract reports that few adverse events led to discontinuation (under 5%) without per-arm figures. [SURMOUNT-3](https://www.primaralabs.com/research/trials/surmount-3) In SURMOUNT-3, a phase 3 trial of tirzepatide in adults with BMI of 30 or more, or 27 or more with at least one obesity-related complication (excluding diabetes), who achieved 5.0% or more weight reduction after a 12-week intensive lifestyle intervention (n=579), mean body weight changed by -18.4% on maximum tolerated dose (10 or 15 mg) over 72 weeks, against +2.5% on placebo (treatment-regimen estimand; Wadden TA et al. Nat Med 2023 (SURMOUNT-3)). In SURMOUNT-3, discontinuation because of adverse events was 10.5% on maximum tolerated dose (10 or 15 mg), against 2.1% on placebo. The most frequently reported adverse events were nausea in 39.7% on maximum tolerated dose (10 or 15 mg) against 14.0% on placebo, diarrhoea in 31.0% on maximum tolerated dose (10 or 15 mg) against 9.2% on placebo, constipation in 23.0% on maximum tolerated dose (10 or 15 mg) against 6.8% on placebo and vomiting in 18.1% on maximum tolerated dose (10 or 15 mg) against 1.4% on placebo. [SURMOUNT-4](https://www.primaralabs.com/research/trials/surmount-4) In SURMOUNT-4, a phase 3 trial of tirzepatide in adults with BMI of 30 or more, or 27 or more with a weight-related complication, excluding diabetes (n=670), mean body weight changed by -5.5% on continued tirzepatide, weeks 36 to 88 over 88 weeks, against +14.0% on switched to placebo (treatment-regimen estimand; Aronne LJ et al. JAMA 2024 (SURMOUNT-4)). In SURMOUNT-4, discontinuation because of adverse events was 1.8% on continued tirzepatide, weeks 36 to 88, against 0.9% on switched to placebo. The most frequently reported adverse events were diarrhoea in 10.7% on continued tirzepatide, weeks 36 to 88 against 4.8% on switched to placebo, nausea in 8.1% on continued tirzepatide, weeks 36 to 88 against 2.7% on switched to placebo and vomiting in 5.7% on continued tirzepatide, weeks 36 to 88 against 1.2% on switched to placebo. [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) In SURMOUNT-5, a phase 3b trial of tirzepatide in adults with obesity but without type 2 diabetes (n=751), mean body weight fell 20.2% on tirzepatide, maximum tolerated dose over 72 weeks, against 13.7% on semaglutide, maximum tolerated dose (Aronne LJ et al. N Engl J Med 2025 (SURMOUNT-5)). SURMOUNT-5: The abstract does not name the estimand or give adverse event rates. Specification ## Compound specification | Compound class | Peptide dual incretin receptor agonist | | Targets or pathway | GIP and GLP-1 receptors | | Sequence | Not published | | Molecular formula | C225H348N48O68[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/166567236) · checked 23 September 2026 | | Molecular weight | 4813 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/166567236) · checked 23 September 2026 | | CAS number | 2023788-19-2[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/166567236) · checked 23 September 2026 | | PubChem CID | [166567236](https://pubchem.ncbi.nlm.nih.gov/compound/166567236) | | Form | Lyophilised powder | | Vial size | 15mg | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 1.0 ml | 15 mg/ml | Highest concentration | | 2.0 ml | 7.5 mg/ml | Common reference dilution | | 3.0 ml | 5 mg/ml | Larger volumes, finer graduation | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for Tirzepatide 15mg](https://www.primaralabs.com/calculator?c=tirzepatide-15mg) Deeper read: [Tirzepatide in the Philippines: research-grade pricing](https://www.primaralabs.com/blog/tirzepatide-philippines) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## Tirzepatide batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA Approved for glycemic control in type 2 diabetes mellitus (Mounjaro); weight reduction in obesity or overweight with a comorbidity and moderate to severe obstructive sleep apnea in adults with obesity (Zepbound) Drugs@FDA: Mounjaro (NDA215866, approved 13 May 2022); Zepbound (NDA217806, approved 8 November 2023). The approval covers the named branded medicine for its labelled use only, never a research-grade vial of the same substance. [Source](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=215866) · checked 23 September 2026 EMA Approved for type 2 diabetes mellitus and weight management (Mounjaro) Mounjaro, EMEA/H/C/005620, authorised 15 September 2022. The authorisation covers the named medicine only. [Source](https://www.ema.europa.eu/en/medicines/human/EPAR/mounjaro) · checked 23 September 2026 Sponsor's next milestone Not published None sought: an approved medicine already exists. Not published [Tirzepatide on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#tirzepatide) Frequently asked ## Tirzepatide questions, answered ### How much does tirzepatide cost at Primara Labs? Tirzepatide 15mg vials are ₱2,100, or ₱1,890 with the standing 10% off. That is the lowest price for a 15mg tirzepatide vial we are aware of in the Philippine market. ### Is tirzepatide currently in stock? It is in stock. Verified orders placed before noon dispatch the same day across Metro Manila, with insulated courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### How does tirzepatide differ from retatrutide in research? Tirzepatide activates GLP-1 and GIP receptors. Retatrutide adds glucagon receptor activity as a third mechanism and produced larger weight reduction in its Phase 2 trial, though tirzepatide has the longer publication record. ### How is tirzepatide delivered? Vials dispatch from Metro Manila stock in insulated cold-chain packaging. Same-day delivery covers Metro Manila on verified orders placed before noon, and provincial couriers reach Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### What is Tirzepatide studied for? Tirzepatide has five completed phase 3 obesity trials in the Research Desk dataset, SURMOUNT-1 to SURMOUNT-5, published between 2022 and 2025. SURMOUNT-5 compared it head to head with semaglutide in adults with obesity without type 2 diabetes. Its wider trial record, including its diabetes programme, is larger than this dataset holds. ### What side effects were reported for Tirzepatide? In SURMOUNT-1, discontinuation because of adverse events was 4.3% on 5 mg, 7.1% on 10 mg and 6.2% on 15 mg, against 2.6% on placebo. In SURMOUNT-3, discontinuation because of adverse events was 10.5% on maximum tolerated dose (10 or 15 mg), against 2.1% on placebo. The most frequently reported adverse events were nausea in 39.7% on maximum tolerated dose (10 or 15 mg) against 14.0% on placebo, diarrhoea in 31.0% on maximum tolerated dose (10 or 15 mg) against 9.2% on placebo, constipation in 23.0% on maximum tolerated dose (10 or 15 mg) against 6.8% on placebo and vomiting in 18.1% on maximum tolerated dose (10 or 15 mg) against 1.4% on placebo. ### Is Tirzepatide approved in the Philippines? Tirzepatide. FDA Philippines: not established. US FDA: Approved for glycemic control in type 2 diabetes mellitus (Mounjaro); weight reduction in obesity or overweight with a comorbidity and moderate to severe obstructive sleep apnea in adults with obesity (Zepbound). Checked 23 September 2026. ### How should Tirzepatide be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for Tirzepatide? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-001 Retatrutide 15mg ₱2,990](https://www.primaralabs.com/marketplace/retatrutide)[PRM-018 Semaglutide 15mg ₱1,990](https://www.primaralabs.com/marketplace/semaglutide-15mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about Tirzepatide, answered - [Is tirzepatide approved in the Philippines?](https://www.primaralabs.com/answers/is-tirzepatide-approved-in-the-philippines) - [How does tirzepatide work?](https://www.primaralabs.com/answers/how-does-tirzepatide-work) - [What are the side effects of tirzepatide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-tirzepatide) - [How much is tirzepatide in the Philippines?](https://www.primaralabs.com/answers/how-much-is-tirzepatide-in-the-philippines) Research Desk ## Tirzepatide on the Research Desk - [Evidence Map: Tirzepatide (Phase 3 human)](https://www.primaralabs.com/research/evidence#tirzepatide) - [Trial: SURMOUNT-1](https://www.primaralabs.com/research/trials/surmount-1) - [Trial: SURMOUNT-2](https://www.primaralabs.com/research/trials/surmount-2) - [Trial: SURMOUNT-3](https://www.primaralabs.com/research/trials/surmount-3) - [Trial: SURMOUNT-4](https://www.primaralabs.com/research/trials/surmount-4) - [Trial: SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Regulatory status: Tirzepatide](https://www.primaralabs.com/research/status#tirzepatide) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/semaglutide-15mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/semaglutide-15mg.md # Semaglutide 15mg, stocked in the Philippines Single GLP-1 receptor agonist, the most extensively published compound in the incretin class. 10% off every order, applied in chat. Presentation Lyophilized powder, 15 mg / vial Catalogue code PRM-018 ## Buy by the pack Swipe, up to 50% off Single vial ₱1,990₱2,210 per vial Single vial, ₱1,990 total 1 vial, 15mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱1,481 per vial 5 vials, ₱7,405 total 5 vials, 75mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱1,105 per vial 10 vials, ₱11,050 total 10 vials, 150mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. Semaglutide. FDA Philippines: not established. US FDA: Approved for glycemic control in type 2 diabetes mellitus and related cardiovascular and kidney risk reduction (Ozempic, Rybelsus); chronic weight management and cardiovascular risk reduction in obesity or overweight (Wegovy). Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order Semaglutide on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20Semaglutide%2015mg%20(%E2%82%B11%2C990).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/semaglutide). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Phase 3 human](https://www.primaralabs.com/research/evidence#semaglutide) FDA Philippines [Not published](https://www.primaralabs.com/research/status#semaglutide) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Overview ## Semaglutide in the Philippines Semaglutide is a GLP-1 receptor agonist and the single-target reference point for the whole incretin class. Where tirzepatide adds GIP activity and retatrutide adds glucagon on top of that, semaglutide acts at GLP-1 alone, which is why it is the comparator arm in most of the trial literature the newer compounds are measured against. In STEP 1 (Wilding et al., NEJM 2021) it produced a mean 14.9% body weight reduction over 68 weeks at the 2.4mg weekly dose. SELECT (Lincoff et al., NEJM 2023) went on to study cardiovascular outcomes in participants with established cardiovascular disease and without diabetes. It carries the longest and most extensively published record of the three. Primara Labs stocks semaglutide as a 15mg lyophilized vial, held in cold storage inside Metro Manila. Because inventory is already in the country there is no international shipping leg, no customs exposure and no multi-week wait. Verified orders placed before noon dispatch the same day across Metro Manila, with courier delivery reaches Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. Every vial ships in insulated cold-chain packaging with the batch number printed on the label, so orders are traceable to their production lot. Pricing is transparent and in pesos: ₱2,210 per vial, or ₱1,990 with the standing 10% off. At 15mg that is ₱133 per milligram with 10% off. Research-grade semaglutide is a different market from the pharmacy product. What is sold here is a lyophilized research chemical, supplied strictly for laboratory use. It is not a finished pharmaceutical, it is not for human consumption, and Primara Labs does not provide medical advice, dosing guidance for people or clinical support. Semaglutide acts at one receptor, GLP-1, and is the single-target reference point for the incretin class. Tirzepatide adds GIP, and retatrutide adds GIP and glucagon, a three-receptor design still in Phase 3 and approved nowhere, where semaglutide under its brand names is an approved medicine in many markets. Both are held in the same Metro Manila cold storage for researchers who [buy retatrutide Philippines](https://www.primaralabs.com/marketplace/retatrutide) stock alongside this vial. ### Research focus - Mechanism: selective agonism at the GLP-1 receptor, studied for its effects on insulin secretion, gastric emptying and appetite signaling. - Structure: a 31-residue analog of human GLP-1, modified for resistance to DPP-4 cleavage and for albumin binding, which is what gives the molecule its long circulating half-life. - STEP 1 (NEJM 2021): 14.9% mean weight reduction at 68 weeks in the 2.4mg weekly arm. - Programme: SUSTAIN in type 2 diabetes, STEP in weight regulation and SELECT in cardiovascular outcomes. The most extensively published compound in the incretin class. - Comparative position: the GLP-1-only reference against which tirzepatide (GLP-1 plus GIP) and retatrutide (GLP-1, GIP plus glucagon) are studied. The added receptor targets in those two are the variable under investigation. ## Benefits studied 1. #### Body-weight reduction Phase 3 human In STEP 1, a phase 3 trial in adults with BMI of 30 or greater (27 or greater with at least one weight-related coexisting condition), without diabetes (n=1,961), mean body weight fell 14.9% on the 2.4 mg arm over 68 weeks, against 2.4% lost on placebo (treatment-policy estimand). [Wilding JPH et al. N Engl J Med 2021;384:989-1002](https://doi.org/10.1056/NEJMoa2032183) · checked 23 September 2026 2. #### Cardiovascular events Phase 3 human In SELECT, a phase 3 trial in patients 45 years or older with preexisting cardiovascular disease and BMI of 27 or greater, no history of diabetes (n=17,604), the primary endpoint, death from cardiovascular causes, nonfatal myocardial infarction or nonfatal stroke, occurred in 6.5% on semaglutide against 8.0% on placebo, a hazard ratio of 0.80 (95% CI 0.72 to 0.90). [Lincoff AM et al. N Engl J Med 2023 (SELECT)](https://doi.org/10.1056/NEJMoa2307563) · checked 23 September 2026 3. #### Body-weight reduction with type 2 diabetes Phase 3 human In STEP 2, a phase 3 trial in adults with BMI of at least 27 kg/m2 and HbA1c 7-10% (53-86 mmol/mol), diagnosed with type 2 diabetes at least 180 days before screening (n=1,210), mean body weight fell 9.6% on the 2.4 mg arm over 68 weeks, against 3.4% lost on placebo. [Davies M et al. Lancet 2021 (STEP 2)](https://doi.org/10.1016/s0140-6736(21)00213-0) · checked 23 September 2026 4. #### Two-year weight reduction Phase 3 human In STEP 5, a phase 3 trial in adults with obesity, or overweight with at least one weight-related comorbidity, without diabetes (n=304), mean body weight fell 15.2% on the 2.4 mg arm over 104 weeks, against 2.6% lost on placebo (treatment-policy estimand). [Garvey WT et al. Nat Med 2022 (STEP 5)](https://doi.org/10.1038/s41591-022-02026-4) · checked 23 September 2026 5. #### Maintenance of weight reduction Phase 3 human In STEP 4, a phase 3 withdrawal trial (n=803), participants who continued semaglutide after a 20-week run-in lost a further 7.9% by week 68, while those switched to placebo regained 6.9%. [Rubino D et al. JAMA 2021 (STEP 4)](https://doi.org/10.1001/jama.2021.3224) · checked 23 September 2026 ## Side effects reported In STEP 3, discontinuation because of adverse events was 5.9% on 2.4 mg, against 2.9% on placebo. The most frequently reported adverse events were gastrointestinal adverse events in 82.8% on 2.4 mg against 63.2% on placebo, nausea in 58.2% on 2.4 mg against 22.1% on placebo, constipation in 36.9% on 2.4 mg against 24.5% on placebo and diarrhoea in 36.1% on 2.4 mg against 22.1% on placebo. [Wadden TA et al. JAMA 2021 (STEP 3)](https://doi.org/10.1001/jama.2021.1831) · checked 23 September 2026 In SELECT, discontinuation because of adverse events was 16.6% on semaglutide 2.4 mg, against 8.2% on placebo. [Lincoff AM et al. N Engl J Med 2023 (SELECT)](https://doi.org/10.1056/NEJMoa2307563) · checked 23 September 2026 In STEP 8, discontinuation because of adverse events was 3.2% on semaglutide 2.4 mg and 12.6% on liraglutide 3.0 mg, against 3.5% on placebo (pooled). The most frequently reported adverse events were gastrointestinal disorders in 84.1% on semaglutide 2.4 mg and 82.7% on liraglutide 3.0 mg against 55.3% on placebo (pooled), nausea in 61.1% on semaglutide 2.4 mg and 59.1% on liraglutide 3.0 mg against 22.4% on placebo (pooled), constipation in 38.9% on semaglutide 2.4 mg and 31.5% on liraglutide 3.0 mg against 23.5% on placebo (pooled) and diarrhoea in 27.8% on semaglutide 2.4 mg and 18.1% on liraglutide 3.0 mg against 25.9% on placebo (pooled). [Rubino DM et al. JAMA 2022 (STEP 8)](https://doi.org/10.1001/jama.2021.23619) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works Semaglutide is a GLP-1 analogue that selectively binds to and activates the GLP-1 receptor, the target of native GLP-1. Targets: GLP-1 receptor [Source](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=42bdd912-2393-44c4-b7e0-47672ca28991) · checked 23 September 2026 Research ## What the research shows Semaglutide at 2.4 mg has seven completed phase 3 trials in the Research Desk dataset: STEP 1 to STEP 5, STEP 8 and SELECT, published between 2021 and 2023. SELECT studied cardiovascular outcomes in people with cardiovascular disease and overweight or obesity without diabetes. Its wider trial record is larger than this dataset holds. [STEP 1](https://www.primaralabs.com/research/trials/step-1) In STEP 1, a phase 3 trial of semaglutide in adults with BMI of 30 or greater (27 or greater with at least one weight-related coexisting condition), without diabetes (n=1,961), mean body weight fell 14.9% on 2.4 mg over 68 weeks, against 2.4% on placebo (treatment-policy estimand; Wilding JPH et al. N Engl J Med 2021;384:989-1002). STEP 1: Discontinuation for adverse events is not given in the abstract; discontinuation for gastrointestinal adverse events was 4.5% against 0.8% on placebo. [STEP 2](https://www.primaralabs.com/research/trials/step-2) In STEP 2, a phase 3 trial of semaglutide in adults with BMI of at least 27 kg/m2 and HbA1c 7-10% (53-86 mmol/mol), diagnosed with type 2 diabetes at least 180 days before screening (n=1,210), mean body weight fell 9.6% on 2.4 mg over 68 weeks, against 3.4% on placebo (Davies M et al. Lancet 2021 (STEP 2)). The most frequently reported adverse events were gastrointestinal adverse events in 63.5% on 2.4 mg and 57.5% on 1.0 mg against 34.3% on placebo. [STEP 3](https://www.primaralabs.com/research/trials/step-3) In STEP 3, a phase 3 trial of semaglutide in US adults without diabetes with overweight (BMI 27 or greater) plus at least 1 comorbidity or obesity (BMI 30 or greater) (n=611), mean body weight fell 16.0% on 2.4 mg over 68 weeks, against 5.7% on placebo (treatment-policy estimand; Wadden TA et al. JAMA 2021 (STEP 3)). In STEP 3, discontinuation because of adverse events was 5.9% on 2.4 mg, against 2.9% on placebo. The most frequently reported adverse events were gastrointestinal adverse events in 82.8% on 2.4 mg against 63.2% on placebo, nausea in 58.2% on 2.4 mg against 22.1% on placebo, constipation in 36.9% on 2.4 mg against 24.5% on placebo and diarrhoea in 36.1% on 2.4 mg against 22.1% on placebo. [STEP 4](https://www.primaralabs.com/research/trials/step-4) In STEP 4, a phase 3 trial of semaglutide in adults with BMI of at least 30 (or 27 or greater with at least 1 weight-related comorbidity) without diabetes, who reached the 2.4 mg maintenance dose during a 20-week run-in (n=803), mean body weight changed by -7.9% on continued 2.4 mg, weeks 20 to 68 over 68 weeks, against +6.9% on switched to placebo (treatment-policy estimand; Rubino D et al. JAMA 2021 (STEP 4)). In STEP 4, discontinuation because of adverse events was 2.4% on continued 2.4 mg, weeks 20 to 68, against 2.2% on switched to placebo. The most frequently reported adverse events were gastrointestinal adverse events in 41.9% on continued 2.4 mg, weeks 20 to 68 against 26.1% on switched to placebo, diarrhoea in 14.4% on continued 2.4 mg, weeks 20 to 68 against 7.1% on switched to placebo, nausea in 14.0% on continued 2.4 mg, weeks 20 to 68 against 4.9% on switched to placebo and constipation in 11.6% on continued 2.4 mg, weeks 20 to 68 against 6.3% on switched to placebo. [STEP 5](https://www.primaralabs.com/research/trials/step-5) In STEP 5, a phase 3 trial of semaglutide in adults with obesity, or overweight with at least one weight-related comorbidity, without diabetes (n=304), mean body weight fell 15.2% on 2.4 mg over 104 weeks, against 2.6% on placebo (treatment-policy estimand; Garvey WT et al. Nat Med 2022 (STEP 5)). In STEP 5, discontinuation because of adverse events was 5.9% on 2.4 mg, against 4.6% on placebo. The most frequently reported adverse events were gastrointestinal adverse events in 82.2% on 2.4 mg against 53.9% on placebo, nausea in 53.3% on 2.4 mg against 21.7% on placebo, diarrhoea in 34.9% on 2.4 mg against 23.7% on placebo and constipation in 30.9% on 2.4 mg against 11.2% on placebo. [STEP 8](https://www.primaralabs.com/research/trials/step-8) In STEP 8, a phase 3b trial of semaglutide in US adults with BMI of 30 or greater, or 27 or greater with 1 or more weight-related comorbidities, without diabetes (n=338), mean body weight fell 15.8% on semaglutide 2.4 mg and 6.4% on liraglutide 3.0 mg over 68 weeks, against 1.9% on placebo (pooled) (treatment-policy estimand; Rubino DM et al. JAMA 2022 (STEP 8)). In STEP 8, discontinuation because of adverse events was 3.2% on semaglutide 2.4 mg and 12.6% on liraglutide 3.0 mg, against 3.5% on placebo (pooled). The most frequently reported adverse events were gastrointestinal disorders in 84.1% on semaglutide 2.4 mg and 82.7% on liraglutide 3.0 mg against 55.3% on placebo (pooled), nausea in 61.1% on semaglutide 2.4 mg and 59.1% on liraglutide 3.0 mg against 22.4% on placebo (pooled), constipation in 38.9% on semaglutide 2.4 mg and 31.5% on liraglutide 3.0 mg against 23.5% on placebo (pooled) and diarrhoea in 27.8% on semaglutide 2.4 mg and 18.1% on liraglutide 3.0 mg against 25.9% on placebo (pooled). Specification ## Compound specification | Compound class | GLP-1 analogue | | Targets or pathway | GLP-1 receptor | | Sequence | Not published | | Molecular formula | C187H291N45O59[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/56843331) · checked 23 September 2026 | | Molecular weight | 4114 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/56843331) · checked 23 September 2026 | | CAS number | 910463-68-2[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/56843331) · checked 23 September 2026 | | PubChem CID | [56843331](https://pubchem.ncbi.nlm.nih.gov/compound/56843331) | | Form | Lyophilised powder | | Vial size | 15mg | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 1.0 ml | 15 mg/ml | Highest concentration, smallest volumes | | 2.0 ml | 7.5 mg/ml | Common reference dilution | | 3.0 ml | 5 mg/ml | Larger volumes, finer graduation | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-30ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for Semaglutide 15mg](https://www.primaralabs.com/calculator?c=semaglutide-15mg) Deeper read: [Tirzepatide vs semaglutide in the Philippines](https://www.primaralabs.com/blog/tirzepatide-vs-semaglutide-philippines) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## Semaglutide batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA Approved for glycemic control in type 2 diabetes mellitus and related cardiovascular and kidney risk reduction (Ozempic, Rybelsus); chronic weight management and cardiovascular risk reduction in obesity or overweight (Wegovy) Drugs@FDA: Ozempic (NDA209637, approved 5 December 2017); WEGOVY (injection) (NDA215256, approved 4 June 2021); RYBELSUS / OZEMPIC (tablets) (NDA213051, approved 20 September 2019); Rybelsus (NDA213182, approved 16 January 2020); WEGOVY (tablets) (NDA218316, approved 22 December 2025). The approval covers the named branded medicine for its labelled use only, never a research-grade vial of the same substance. [Source](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=209637) · checked 23 September 2026 EMA Approved for type 2 diabetes mellitus (Ozempic, Rybelsus), weight management (Wegovy) and non-cirrhotic MASH with F2 to F3 fibrosis (Kayshild) Five authorised products containing semaglutide, all held by Novo Nordisk A/S. The authorisation covers the named medicines only. [Source](https://www.ema.europa.eu/en/medicines/human/EPAR/ozempic) · checked 23 September 2026 Sponsor's next milestone Not published None sought: an approved medicine already exists. Not published [Semaglutide on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#semaglutide) Frequently asked ## Semaglutide questions, answered ### How much does semaglutide cost in the Philippines? Primara Labs supplies semaglutide 15mg vials at ₱2,210, or ₱1,990 with the standing 10% off, which works out at ₱133 per milligram. Stock is held inside the Philippines, so there are no import fees, customs risk or international shipping costs on top. ### Is semaglutide in stock and how fast is delivery? Semaglutide 15mg is in stock. Verified orders placed before noon dispatch the same day across Metro Manila. Provincial orders ship by insulated courier and reach Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### How does research-grade semaglutide differ from the pharmacy product? They are different categories. The pharmacy product is a finished, prescription-only preparation supplied in a pen at a fixed concentration. What is sold here is lyophilized powder in a vial, supplied as a research chemical for laboratory use, with no prescription and no clinical support attached. ### How is semaglutide reconstituted for research use? The lyophilized powder is reconstituted with bacteriostatic water. Adding 2.0 ml to a 15mg vial yields a 7.5 mg/ml reference concentration, and 1.0 ml yields 15 mg/ml. Reconstituted material should be refrigerated and used within 28 days. ### How does semaglutide compare with tirzepatide and retatrutide? By receptor targets. Semaglutide acts at GLP-1 only, tirzepatide at GLP-1 and GIP, retatrutide at GLP-1, GIP and glucagon. All three are stocked here as 15mg vials, so the per-milligram comparison is direct rather than confounded by different vial sizes. ### How do I order semaglutide from Primara Labs? Ordering runs through WhatsApp. Tap the order button on this page and the chat opens with your vial pre-filled. Confirm quantity and delivery details in the conversation and payment instructions follow there. ### What is Semaglutide studied for? Semaglutide at 2.4 mg has seven completed phase 3 trials in the Research Desk dataset: STEP 1 to STEP 5, STEP 8 and SELECT, published between 2021 and 2023. SELECT studied cardiovascular outcomes in people with cardiovascular disease and overweight or obesity without diabetes. Its wider trial record is larger than this dataset holds. ### What side effects were reported for Semaglutide? In STEP 3, discontinuation because of adverse events was 5.9% on 2.4 mg, against 2.9% on placebo. The most frequently reported adverse events were gastrointestinal adverse events in 82.8% on 2.4 mg against 63.2% on placebo, nausea in 58.2% on 2.4 mg against 22.1% on placebo, constipation in 36.9% on 2.4 mg against 24.5% on placebo and diarrhoea in 36.1% on 2.4 mg against 22.1% on placebo. In SELECT, discontinuation because of adverse events was 16.6% on semaglutide 2.4 mg, against 8.2% on placebo. In STEP 8, discontinuation because of adverse events was 3.2% on semaglutide 2.4 mg and 12.6% on liraglutide 3.0 mg, against 3.5% on placebo (pooled). The most frequently reported adverse events were gastrointestinal disorders in 84.1% on semaglutide 2.4 mg and 82.7% on liraglutide 3.0 mg against 55.3% on placebo (pooled), nausea in 61.1% on semaglutide 2.4 mg and 59.1% on liraglutide 3.0 mg against 22.4% on placebo (pooled), constipation in 38.9% on semaglutide 2.4 mg and 31.5% on liraglutide 3.0 mg against 23.5% on placebo (pooled) and diarrhoea in 27.8% on semaglutide 2.4 mg and 18.1% on liraglutide 3.0 mg against 25.9% on placebo (pooled). ### Is Semaglutide approved in the Philippines? Semaglutide. FDA Philippines: not established. US FDA: Approved for glycemic control in type 2 diabetes mellitus and related cardiovascular and kidney risk reduction (Ozempic, Rybelsus); chronic weight management and cardiovascular risk reduction in obesity or overweight (Wegovy). Checked 23 September 2026. ### How should Semaglutide be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for Semaglutide? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-001 Retatrutide 15mg ₱2,990](https://www.primaralabs.com/marketplace/retatrutide)[PRM-006 Tirzepatide 15mg ₱1,890](https://www.primaralabs.com/marketplace/tirzepatide-15mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about Semaglutide, answered - [Is semaglutide approved in the Philippines?](https://www.primaralabs.com/answers/is-semaglutide-approved-in-the-philippines) - [How does semaglutide work?](https://www.primaralabs.com/answers/how-does-semaglutide-work) - [What are the side effects of semaglutide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-semaglutide) Research Desk ## Semaglutide on the Research Desk - [Evidence Map: Semaglutide (Phase 3 human)](https://www.primaralabs.com/research/evidence#semaglutide) - [Trial: STEP 1](https://www.primaralabs.com/research/trials/step-1) - [Trial: STEP 2](https://www.primaralabs.com/research/trials/step-2) - [Trial: STEP 3](https://www.primaralabs.com/research/trials/step-3) - [Trial: STEP 4](https://www.primaralabs.com/research/trials/step-4) - [Trial: STEP 5](https://www.primaralabs.com/research/trials/step-5) - [Trial: STEP 8](https://www.primaralabs.com/research/trials/step-8) - [Trial: SELECT](https://www.primaralabs.com/research/trials/select) - [Regulatory status: Semaglutide](https://www.primaralabs.com/research/status#semaglutide) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/bpc-157-20mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/bpc-157-20mg.md # BPC-157 20mg, stocked in the Philippines Pentadecapeptide sequence derived from a gastric protein. Studied for soft tissue and gut repair. 10% off every order, applied in chat. Presentation Lyophilized powder, 20 mg / vial Catalogue code PRM-002 ## Buy by the pack Swipe, up to 50% off Single vial ₱2,390₱2,650 per vial Single vial, ₱2,390 total 1 vial, 20mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱1,775 per vial 5 vials, ₱8,875 total 5 vials, 100mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱1,325 per vial 10 vials, ₱13,250 total 10 vials, 200mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. BPC-157. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order BPC-157 on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20BPC-157%2020mg%20(%E2%82%B12%2C390).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/bpc-157). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Small human studies](https://www.primaralabs.com/research/evidence#bpc-157) FDA Philippines [Not published](https://www.primaralabs.com/research/status#bpc-157) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/recovery?ref=pl) Overview ## BPC-157 in the Philippines BPC-157 is a synthetic pentadecapeptide derived from a protective protein found in human gastric juice. It is one of the most widely studied compounds in the recovery peptide literature, with animal-model research spanning tendon and ligament repair, gastrointestinal mucosa protection, angiogenesis and NO-system signaling. Primara Labs supplies BPC-157 in a 20mg presentation, double the 10mg vials most suppliers in the Philippines carry. On a per-milligram basis that makes it one of the strongest values in the catalogue at ₱2,650 per vial, or ₱2,390 with the standing 10% off. Vials are stocked in Metro Manila and dispatch same day on verified orders placed before noon, with insulated courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. Every vial carries its batch number on the label and ships cold-chain from door to door. BPC-157 is not FDA approved and is supplied strictly for laboratory research. It is not for human consumption, and nothing on this page is medical advice. ### Research focus - Tendon and ligament models: accelerated fibroblast migration and tendon-to-bone healing in rodent studies. - Gastrointestinal research: mucosal protection and healing across ulcer, fistula and inflammatory bowel models, the compound's original study context. - Angiogenesis: upregulation of VEGF expression and early vessel formation in injury models. - Systemic versus local administration is an open research question. Both routes show activity in animal work. ## Benefits studied 1. #### Interstitial cystitis symptoms Small human studies In an uncontrolled pilot of 12 women with interstitial cystitis, 10 reported complete symptom resolution; there was no placebo or comparison group. [PubMed 39325560](https://pubmed.ncbi.nlm.nih.gov/39325560/) · checked 23 September 2026 2. #### Knee pain Small human studies In a retrospective phone survey of 16 clinic patients, 14 reported knee pain relief; there was no control group and no validated outcome measure. [PubMed 34324435](https://pubmed.ncbi.nlm.nih.gov/34324435/) · checked 23 September 2026 3. #### Tendon repair Animal and cell In rats with a cut Achilles tendon, BPC-157 improved mechanical, functional and microscopic healing measures compared with saline. [J Orthop Res 2003](https://doi.org/10.1016/s0736-0266(03)00110-4) · checked 23 September 2026 4. #### Ligament repair Animal and cell In rats with a surgically cut knee ligament, BPC-157 improved functional, mechanical and tissue measures of healing over 90 days. [J Orthop Res 2010](https://doi.org/10.1002/jor.21107) · checked 23 September 2026 ## Side effects reported The two small uncontrolled pilots, of 2 and 12 people, reported no adverse events. A 2025 systematic review states that no clinical safety data were found. [HSS J 2025 (systematic review)](https://doi.org/10.1177/15563316251355551) · checked 23 September 2026 No human adverse event data published. [Europe PMC and ClinicalTrials.gov search, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22BPC-157%22%20OR%20TITLE_ABS%3A%22BPC%20157%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works BPC-157 is a synthetic 15-amino-acid peptide. A 2025 systematic review summarises animal and cell studies as showing raised growth hormone receptor expression, activation of pathways for cell growth and new blood vessel formation, and lower inflammatory signalling. No receptor has been identified, and the same review notes it is broken down quickly in the liver. None of these mechanisms has been shown in people. Targets: No defined receptor; pathways proposed from animal and cell work [Source](https://doi.org/10.1177/15563316251355551) · checked 23 September 2026 Research ## What the research shows BPC-157 has no completed human randomised controlled trial. Its human data are three small uncontrolled reports of 2 to 16 people, and a 2025 systematic review found no clinical safety data. Almost all of its literature is rat work on tendon, ligament and gut healing. Animal and cell Animal and cell studies only. BPC-157 has been studied mostly in rats, in models of tendon, ligament, muscle and gut injury. - In rats with a cut Achilles tendon, BPC-157 improved load to failure, function and tissue appearance compared with saline. [J Orthop Res 2003](https://doi.org/10.1016/s0736-0266(03)00110-4) · checked 23 September 2026 - In rats with a surgically cut knee ligament, BPC-157 improved functional, mechanical and tissue measures of healing over 90 days. [J Orthop Res 2010](https://doi.org/10.1002/jor.21107) · checked 23 September 2026 - In rats with restricted then restored blood flow to the hind limb, BPC-157 lowered markers of oxidative stress and cell death. [Sci Rep 2026](https://doi.org/10.1038/s41598-026-55449-1) · checked 23 September 2026 Specification ## Compound specification | Compound class | Synthetic pentadecapeptide | | Targets or pathway | No defined receptor; pathways proposed from animal and cell work | | Sequence | GEPPPGKPADDAGLV[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | Molecular formula | C62H98N16O22[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | Molecular weight | 1419.5 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | CAS number | 137525-51-0[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | PubChem CID | [9941957](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) | | Form | Lyophilised powder | | Vial size | 20mg | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 2.0 ml | 10 mg/ml | Common reference dilution | | 4.0 ml | 5 mg/ml | Finer graduation per unit volume | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-30ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for BPC-157 20mg](https://www.primaralabs.com/calculator?c=bpc-157-20mg) Deeper read: [BPC-157 in Manila: price, stock and same-day delivery](https://www.primaralabs.com/blog/bpc-157-manila) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## BPC-157 batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22BPC-157%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [BPC-157 on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#bpc-157) Frequently asked ## BPC-157 questions, answered ### How much does BPC-157 cost in the Philippines? Primara Labs supplies BPC-157 in 20mg vials at ₱2,650, or ₱2,390 with the standing 10% off. Most local suppliers sell 10mg vials, so on a per-milligram basis the 20mg presentation is one of the best values in the catalogue. ### Is BPC-157 in stock and how fast is delivery? BPC-157 20mg is in stock. Verified Metro Manila orders placed before noon dispatch the same day. Courier delivery in insulated packaging reaches Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### How is a 20mg BPC-157 vial reconstituted? Adding 2.0 ml of bacteriostatic water to the 20mg vial yields a 10 mg/ml reference concentration, and 4.0 ml yields 5 mg/ml. Refrigerate after reconstitution and use within 28 days. ### What is BPC-157 studied with in recovery research? In the research literature BPC-157 is most often paired with TB-500, a thymosin beta-4 fragment studied for complementary activity on cell migration and soft-tissue repair. Primara Labs stocks both when available. ### Why buy BPC-157 from a local Philippine supplier? Local stock means no customs screening, no long international transit and cold-chain integrity from Metro Manila storage to your door. Same-day dispatch covers Metro Manila and couriers reach Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### What is BPC-157 studied for? BPC-157 has no completed human randomised controlled trial. Its human data are three small uncontrolled reports of 2 to 16 people, and a 2025 systematic review found no clinical safety data. Almost all of its literature is rat work on tendon, ligament and gut healing. ### What side effects were reported for BPC-157? The two small uncontrolled pilots, of 2 and 12 people, reported no adverse events. A 2025 systematic review states that no clinical safety data were found. ### Is BPC-157 approved in the Philippines? BPC-157. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. ### How should BPC-157 be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for BPC-157? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-008 TB-500 10mg ₱2,390](https://www.primaralabs.com/marketplace/tb-500-10mg)[PRM-016 GLOW Blend 70mg ₱3,490](https://www.primaralabs.com/marketplace/glow-blend-70mg)[PRM-017 KLOW Blend 80mg ₱3,990](https://www.primaralabs.com/marketplace/klow-blend-80mg)[PRM-004 GHK-Cu 50mg ₱1,190](https://www.primaralabs.com/marketplace/ghk-cu-50mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about BPC-157, answered - [Is BPC-157 FDA approved?](https://www.primaralabs.com/answers/is-bpc-157-fda-approved) - [Is there human research on BPC-157?](https://www.primaralabs.com/answers/is-there-human-research-on-bpc-157) - [What are the side effects of BPC-157?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-bpc-157) Research Desk ## BPC-157 on the Research Desk - [Evidence Map: BPC-157 (Small human studies)](https://www.primaralabs.com/research/evidence#bpc-157) - [Regulatory status: BPC-157](https://www.primaralabs.com/research/status#bpc-157) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/tb-500-10mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/tb-500-10mg.md # TB-500 10mg, stocked in the Philippines Synthetic fragment of thymosin beta-4. Studied for cell migration and tissue repair. 10% off every order, applied in chat. Presentation Lyophilized powder, 10 mg / vial Catalogue code PRM-008 ## Buy by the pack Swipe, up to 50% off Single vial ₱2,390₱2,650 per vial Single vial, ₱2,390 total 1 vial, 10mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱1,775 per vial 5 vials, ₱8,875 total 5 vials, 50mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱1,325 per vial 10 vials, ₱13,250 total 10 vials, 100mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. TB-500. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order TB-500 on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20TB-500%2010mg%20(%E2%82%B12%2C390).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/tb-500). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Animal and cell](https://www.primaralabs.com/research/evidence#tb-500) FDA Philippines [Not published](https://www.primaralabs.com/research/status#tb-500) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/recovery?ref=pl) Overview ## TB-500 in the Philippines TB-500 is a synthetic fragment of thymosin beta-4, an actin-binding protein present in nearly all human and animal cells. Research interest centers on actin sequestration, cell migration and the downstream effects on soft-tissue repair and flexibility observed in animal models. Primara Labs stocks TB-500 as a 10mg lyophilized vial at ₱2,650, or ₱2,390 with the standing 10% off. Local pricing on 10mg vials varies widely between suppliers, so the figure worth comparing is the price per milligram rather than the headline number on a vial. In the recovery research literature it is most often studied alongside BPC-157, and the catalogue presents the two as a pair. TB-500 is supplied for laboratory research only and is not for human use. ### Research focus - Actin regulation: sequestration of G-actin monomers, the mechanism behind its cell-migration effects. - Soft-tissue models: improved flexibility and repair markers in rodent tendon and muscle studies. - Frequently studied in combination with BPC-157 for complementary repair pathways. ## Benefits studied 1. #### Skin wound repair Animal and cell In aged and diabetic mice, the seven-amino-acid thymosin beta-4 fragment LKKTETQ promoted skin wound repair about as well as the full-length protein. [Wound Repair Regen 2003](https://doi.org/10.1046/j.1524-475x.2003.11105.x) · checked 23 September 2026 2. #### Cell wound closure Animal and cell In a cell scratch-wound test, the TB-500 breakdown product Ac-LKKTE showed wound-healing activity, while TB-500 itself did not. [J Chromatogr B 2024](https://doi.org/10.1016/j.jchromb.2024.124033) · checked 23 September 2026 ## Side effects reported No human adverse event data exist for TB-500. In the phase 3 trial of full-length thymosin beta-4 eye drops (ARISE-3), a different molecule, instillation site pain occurred in 6.6% against 4.6% on placebo. [ClinicalTrials.gov NCT03937882 results](https://clinicaltrials.gov/study/NCT03937882) · checked 23 September 2026 No human adverse event data published. [Europe PMC and ClinicalTrials.gov search, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22TB-500%22%20OR%20TITLE_ABS%3A%22TB500%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works Thymosin beta-4 is a 43-amino-acid protein and the main actin-sequestering molecule in cells. Its central actin-binding sequence, LKKTETQ, is reported to promote cell migration, new blood vessel growth and wound healing, and TB-500 is described in the analytical literature as the acetylated form of that fragment. A 2024 cell study found the wound-healing activity came from a TB-500 breakdown product rather than TB-500 itself. Targets: Actin binding (the LKKTETQ sequence of thymosin beta-4) [Source](https://doi.org/10.1096/fj.09-142307) · checked 23 September 2026 Research ## What the research shows No human trial of TB-500, the acetylated thymosin beta-4 fragment Ac-LKKTETQ, has reported; its evidence is animal and cell work. Full-length thymosin beta-4 has been studied in people, mostly as eye drops, where two phase 3 dry-eye trials posted near-identical results in both arms. A 2024 cell study found the wound-healing activity came from a TB-500 breakdown product rather than TB-500 itself. Animal and cell Animal and cell studies only for TB-500. Human trials exist for full-length thymosin beta-4, a different molecule, mostly as eye drops; see the Evidence Map. - In aged and diabetic mice, the seven-amino-acid fragment LKKTETQ promoted skin wound repair about as well as full-length thymosin beta-4. [Wound Repair Regen 2003](https://doi.org/10.1046/j.1524-475x.2003.11105.x) · checked 23 September 2026 - In a cell scratch-wound test, only the TB-500 breakdown product Ac-LKKTE showed wound-healing activity, not TB-500 itself. [J Chromatogr B 2024](https://doi.org/10.1016/j.jchromb.2024.124033) · checked 23 September 2026 - A rat Achilles tendon repair study described its molecule as synthetic thymosin beta-4 (TB-500) without stating the sequence in the abstract. [Jt Dis Relat Surg 2026](https://doi.org/10.52312/jdrs.2026.2951) · checked 23 September 2026 Specification ## Compound specification | Compound class | Thymosin beta-4 related peptide | | Targets or pathway | Actin binding (the LKKTETQ sequence of thymosin beta-4) | | Sequence | Confirming with supplier | | Molecular formula | Confirming with supplier | | Molecular weight | Confirming with supplier | | CAS number | Confirming with supplier | | PubChem CID | Not published | | Form | Lyophilised powder | | Vial size | 10mg | The catalogue listed the full 43-residue thymosin beta-4 sequence under the name TB-500, while the analytical literature identifies TB-500 as the fragment Ac-LKKTETQ, and the catalogue's formula matched neither PubChem record. Identity fields are withheld until the supplier confirms which molecule the vial contains. Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 1.0 ml | 10 mg/ml | Concentrated, small draw volumes | | 2.0 ml | 5 mg/ml | Common reference dilution | | 4.0 ml | 2.5 mg/ml | Finer graduation | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-30ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for TB-500 10mg](https://www.primaralabs.com/calculator?c=tb-500-10mg) Deeper read: [TB-500 in the Philippines: the recovery stack](https://www.primaralabs.com/blog/tb-500-philippines) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## TB-500 batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22thymosin%20beta-4%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [TB-500 on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#tb-500) Frequently asked ## TB-500 questions, answered ### How much does TB-500 cost at Primara Labs? TB-500 10mg vials are ₱2,650, or ₱2,390 with the standing 10% off. The vial is a 10mg presentation, which is the same size most local suppliers list, so the peso figure compares directly rather than needing to be halved or doubled. ### Is TB-500 currently available? It is in stock. Verified orders placed before noon dispatch the same day across Metro Manila, with insulated courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### Why are TB-500 and BPC-157 studied together? The two compounds act on different repair pathways, actin regulation for TB-500 and angiogenic signaling for BPC-157, so recovery research protocols frequently run them in parallel. ### What is TB-500 studied for? No human trial of TB-500, the acetylated thymosin beta-4 fragment Ac-LKKTETQ, has reported; its evidence is animal and cell work. Full-length thymosin beta-4 has been studied in people, mostly as eye drops, where two phase 3 dry-eye trials posted near-identical results in both arms. A 2024 cell study found the wound-healing activity came from a TB-500 breakdown product rather than TB-500 itself. ### What side effects were reported for TB-500? No human adverse event data exist for TB-500. In the phase 3 trial of full-length thymosin beta-4 eye drops (ARISE-3), a different molecule, instillation site pain occurred in 6.6% against 4.6% on placebo. ### Is TB-500 approved in the Philippines? TB-500. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. ### How should TB-500 be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for TB-500? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-002 BPC-157 20mg ₱2,390](https://www.primaralabs.com/marketplace/bpc-157-20mg)[PRM-016 GLOW Blend 70mg ₱3,490](https://www.primaralabs.com/marketplace/glow-blend-70mg)[PRM-017 KLOW Blend 80mg ₱3,990](https://www.primaralabs.com/marketplace/klow-blend-80mg)[PRM-004 GHK-Cu 50mg ₱1,190](https://www.primaralabs.com/marketplace/ghk-cu-50mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about TB-500, answered - [Is TB-500 FDA approved?](https://www.primaralabs.com/answers/is-tb-500-fda-approved) - [What is TB-500?](https://www.primaralabs.com/answers/what-is-tb-500) Research Desk ## TB-500 on the Research Desk - [Evidence Map: TB-500 (Animal and cell)](https://www.primaralabs.com/research/evidence#tb-500) - [Regulatory status: TB-500](https://www.primaralabs.com/research/status#tb-500) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/nad-1000mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/nad-1000mg.md # NAD+ 1000mg, Philippines Nicotinamide adenine dinucleotide. Coenzyme central to mitochondrial energy transfer. 10% off every order, applied in chat. Presentation Lyophilized powder, 1000 mg / vial Catalogue code PRM-003 ## Buy by the pack Swipe, up to 50% off Single vial ₱2,590₱2,875 per vial Single vial, ₱2,590 total 1 vial, 1,000mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱1,926 per vial 5 vials, ₱9,630 total 5 vials, 5,000mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱1,438 per vial 10 vials, ₱14,380 total 10 vials, 10,000mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. NAD+. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order NAD+ on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20NAD%2B%201000mg%20(%E2%82%B12%2C590).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/nad). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Small human studies](https://www.primaralabs.com/research/evidence#nad) FDA Philippines [Not published](https://www.primaralabs.com/research/status#nad) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/energy?ref=pl) Overview ## NAD+ in the Philippines NAD+ (nicotinamide adenine dinucleotide) is an essential coenzyme in cellular redox chemistry and the substrate for sirtuins and PARP enzymes. Cellular NAD+ levels decline with age, which has made restoration a central theme in longevity research. Primara Labs supplies NAD+ in a 1000mg presentation at ₱2,875, or ₱2,590 with the standing 10% off. The high-dose format suits infusion-style research protocols that consume material quickly. NAD+ is supplied for laboratory research only, stocked locally with same-day Metro Manila dispatch on verified orders placed before noon. NAD+ is the largest vial in the catalogue at 1000mg, and it is also the most heat-sensitive, so keep it refrigerated and shaded and avoid letting it warm up and cool down again. Orders run through WhatsApp: tap the button, send the pre-filled message, and we come back with stock and a delivery time. Provincial orders reach 1 to 2 days Luzon, 2 to 3 Visayas, 3 to 5 Mindanao. For how NAD+ works in the cell, see the [NAD+ guide](https://www.philippinespeptides.com/peptides/nad). ### Research focus - Redox biology: NAD+/NADH cycling in mitochondrial energy production. - Sirtuin activation: NAD+ as the required substrate for SIRT1-7 activity. - DNA repair: PARP enzyme dependence on NAD+ availability. ## Benefits studied 1. #### Heart pumping function in heart failure Small human studies In a single-centre randomised trial of 180 adults with heart failure from ischaemic heart disease, with no phase stated, ejection fraction at one month was 45.44% on NAD+ against 42.44% on placebo; differences in clinical events were not statistically significant. [Am J Cardiovasc Drugs 2026](https://doi.org/10.1007/s40256-025-00764-7) · checked 23 September 2026 2. #### Blood NAD levels Small human studies In a phase 0/1b randomised trial in healthy adults aged 45 to 75, an oral NAD+ formulation raised whole-blood NAD inside cells by 53% against placebo after five days; no clinical endpoint held up after correction for multiple testing. [GeroScience 2026](https://doi.org/10.1007/s11357-026-02399-1) · checked 23 September 2026 3. #### Heart muscle after blocked blood flow Animal and cell In pigs with a 90-minute coronary artery blockage, NAD+ given before blood flow was restored reduced heart muscle death and improved recovery of heart function compared with saline. [PubMed 31632574](https://pubmed.ncbi.nlm.nih.gov/31632574/) · checked 23 September 2026 4. #### Brain injury after stroke Animal and cell In mice with a temporary stroke, NAD+ reduced the size of the damaged area, brain swelling and neurological deficits. [Front Pharmacol 2023](https://doi.org/10.3389/fphar.2023.1096533) · checked 23 September 2026 ## Side effects reported In the 180-person heart-failure trial, one of 90 on NAD+ reported minor dizziness. [Am J Cardiovasc Drugs 2026](https://doi.org/10.1007/s40256-025-00764-7) · checked 23 September 2026 In a retrospective review at a commercial clinic, all 6 people given intravenous NAD+ reported stomach cramping, diarrhoea, nausea, vomiting, a faster heart rate or chest pressure during the infusion. [Front Aging 2026](https://doi.org/10.3389/fragi.2026.1652582) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works NAD+ is a coenzyme central to cellular energy metabolism and redox balance, and a cofactor for enzymes involved in DNA repair and metabolism. Its levels fall with age, which is the rationale researchers give for supplementation. When infused into people it is cleared from plasma quickly and broken down by NAD-consuming enzymes, so how much reaches cells intact is unclear. Targets: Cellular energy metabolism and redox reactions; cofactor for DNA-repair and metabolic enzymes [Source](https://doi.org/10.1007/s40256-025-00764-7) · checked 23 September 2026 Research ## What the research shows NAD+ is a coenzyme central to cellular energy metabolism. Three small randomised trials have given NAD+ itself to people, the largest an intravenous trial in 180 adults with ischaemic heart failure; none is a phase 2 or phase 3 trial. Most human research on raising NAD uses precursors such as NR and NMN, which are different molecules. Specification ## Compound specification | Compound class | Coenzyme (dinucleotide) | | Targets or pathway | Cellular energy metabolism and redox reactions; cofactor for DNA-repair and metabolic enzymes | | Sequence | Not published | | Molecular formula | C21H27N7O14P2[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/5892) · checked 23 September 2026 | | Molecular weight | 663.4 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/5892) · checked 23 September 2026 | | CAS number | Not published | | PubChem CID | [5892](https://pubchem.ncbi.nlm.nih.gov/compound/5892) | | Form | Lyophilised powder | | Vial size | 1000mg | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 10 ml | 100 mg/ml | High-dose protocol reference | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for NAD+ 1000mg](https://www.primaralabs.com/calculator?c=nad-1000mg) Deeper read: [NAD+ in the Philippines: vial pricing versus clinic drips](https://www.primaralabs.com/blog/nad-philippines) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## NAD+ batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22NAD%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [NAD+ on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#nad) Frequently asked ## NAD+ questions, answered ### How much does NAD+ cost in the Philippines? Primara Labs supplies NAD+ 1000mg vials at ₱2,875, or ₱2,590 with the standing 10% off. ### Is the 1000mg vial a single-use presentation? The 1000mg format is designed for research protocols that consume material at infusion scale. Reconstituted NAD+ should be used promptly, so size protocols to the vial. ### How is NAD+ shipped? Vials dispatch from Metro Manila stock in insulated packaging. Same-day delivery covers Metro Manila on verified orders before noon, with courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### What is NAD+ studied for? NAD+ is a coenzyme central to cellular energy metabolism. Three small randomised trials have given NAD+ itself to people, the largest an intravenous trial in 180 adults with ischaemic heart failure; none is a phase 2 or phase 3 trial. Most human research on raising NAD uses precursors such as NR and NMN, which are different molecules. ### What side effects were reported for NAD+? In the 180-person heart-failure trial, one of 90 on NAD+ reported minor dizziness. In a retrospective review at a commercial clinic, all 6 people given intravenous NAD+ reported stomach cramping, diarrhoea, nausea, vomiting, a faster heart rate or chest pressure during the infusion. ### Is NAD+ approved in the Philippines? NAD+. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. ### How should NAD+ be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for NAD+? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-009 MOTS-c 10mg ₱1,890](https://www.primaralabs.com/marketplace/mots-c-10mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about NAD+, answered - [Is NAD+ FDA approved?](https://www.primaralabs.com/answers/is-nad-plus-fda-approved) - [What does research show on NAD+ injections?](https://www.primaralabs.com/answers/what-does-research-show-on-nad-injections) Research Desk ## NAD+ on the Research Desk - [Evidence Map: NAD+ (Small human studies)](https://www.primaralabs.com/research/evidence#nad) - [Regulatory status: NAD+](https://www.primaralabs.com/research/status#nad) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/ghk-cu-50mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/ghk-cu-50mg.md # GHK-Cu 50mg, Philippines Copper-binding tripeptide. Studied for dermal collagen and wound repair signalling. 10% off every order, applied in chat. Presentation Lyophilized powder, 50 mg / vial Catalogue code PRM-004 ## Buy by the pack Swipe, up to 50% off Single vial ₱1,190₱1,325 per vial Single vial, ₱1,190 total 1 vial, 50mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱888 per vial 5 vials, ₱4,440 total 5 vials, 250mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱663 per vial 10 vials, ₱6,630 total 10 vials, 500mg total 10 x 3ml water · 100 syringes · 100 pads Courier is a flat rate per region, on the delivery page. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. GHK-Cu. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order GHK-Cu on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20GHK-Cu%2050mg%20(%E2%82%B11%2C190).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/ghk-cu). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Small human studies](https://www.primaralabs.com/research/evidence#ghk-cu) FDA Philippines [Not published](https://www.primaralabs.com/research/status#ghk-cu) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/skin?ref=pl) Overview ## GHK-Cu in the Philippines GHK-Cu is a naturally occurring copper-binding tripeptide, present in human plasma at high levels in youth and declining sharply with age. It is one of the most cited compounds in dermal and regenerative peptide research, with published work on collagen synthesis, wound healing, antioxidant gene expression and skin remodeling. Primara Labs supplies GHK-Cu in a 50mg presentation at ₱1,325 per vial, or ₱1,190 with the standing 10% off, the most accessible entry point in the catalogue. The 50mg format suits both injection-based research protocols and topical formulation work, where the powder is compounded into serums or creams at research concentrations. Vials are stocked in Metro Manila with same-day dispatch on verified orders placed before noon and courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. Every vial is batch-numbered on the label and ships in insulated packaging. GHK-Cu is supplied strictly for laboratory research use. It is not FDA approved and nothing on this page constitutes medical or cosmetic advice. GHK-Cu arrives as a blue-tinged powder in a 50mg vial. Copper peptides pull moisture from the air and fade in light, so the vial stays sealed, cold and dark. When mixed, the liquid turns a clear blue, which is normal. To order, open WhatsApp from this page; the message names the vial, and we confirm the total and delivery. Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. Skin and hair research on the compound is summarised in the [GHK-Cu guide](https://www.philippinespeptides.com/peptides/ghk-cu). ### Research focus - Collagen and elastin synthesis: stimulation of fibroblast collagen production in dermal models, the foundation of its use in cosmetic research. - Gene expression: published microarray work shows GHK resetting expression of thousands of genes toward a younger profile, including antioxidant and repair pathways. - Wound healing: accelerated closure and improved remodeling in animal wound models. - Hair follicle research: follicle enlargement and anagen-phase support in early studies, the basis of its appearance in hair-loss research formulations. ## Benefits studied 1. #### Diabetic foot ulcer closure Small human studies In a randomised, evaluator-blinded, placebo-controlled trial of a GHK-Cu gel on diabetic foot ulcers, median ulcer closure was 98.5% with the gel against 60.8% with the inactive gel; the abstract does not state the trial's size or phase. [Wound Repair Regen 1994](https://doi.org/10.1046/j.1524-475x.1994.20406.x) · checked 23 September 2026 2. #### Skin after laser resurfacing (no measured benefit) Small human studies In 13 randomised patients after laser skin resurfacing, GHK-Cu skin care made no measurable difference to redness, wrinkles or blinded ratings, though patients rated their skin quality higher. [Arch Facial Plast Surg 2006](https://doi.org/10.1001/archfaci.8.4.252) · checked 23 September 2026 3. #### Ligament graft healing Animal and cell In rats after knee ligament reconstruction, GHK-Cu reduced knee laxity at 6 weeks, but the difference had gone by 12 weeks. [J Orthop Res 2015](https://doi.org/10.1002/jor.22831) · checked 23 September 2026 4. #### Fibroblast growth Animal and cell In cell culture, GHK-Cu shortened the doubling time of normal and irradiated human skin fibroblasts and raised their early output of growth factors. [Arch Facial Plast Surg 2005](https://doi.org/10.1001/archfaci.7.1.27) · checked 23 September 2026 ## Side effects reported No human adverse event data published. [Europe PMC and ClinicalTrials.gov search, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22GHK-Cu%22%20OR%20TITLE_ABS%3A%22copper%20tripeptide%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works GHK is a tripeptide (glycine, histidine, lysine) found in human plasma, saliva and urine, and it binds copper. In laboratory work it stimulates both the production and the breakdown of collagen and related skin matrix molecules, and adjusts the enzymes that remodel tissue. The evidence for these actions comes from cell and animal studies. Targets: Copper binding; tissue remodelling enzymes (from cell and animal work) [Source](https://doi.org/10.1155/2015/648108) · checked 23 September 2026 Research ## What the research shows GHK-Cu is a copper-binding tripeptide found in human plasma. Its human evidence is two small topical trials, one in diabetic foot ulcers from 1994 and one after laser skin resurfacing that found no objective benefit; a 2025 review notes a surprising absence of clinical studies. Most of its literature is cell and animal work. Animal and cell Mostly cell and animal work. The two human trials found are small and topical. - In rats after knee ligament reconstruction, GHK-Cu reduced knee laxity at 6 weeks; the difference had gone by 12 weeks. [J Orthop Res 2015](https://doi.org/10.1002/jor.22831) · checked 23 September 2026 - In an irradiated rat wound model, topical GHK-Cu showed no benefit. [Otolaryngol Head Neck Surg 2013](https://doi.org/10.1177/0194599813492644) · checked 23 September 2026 - In cell culture, GHK-Cu shortened the doubling time of normal and irradiated human skin fibroblasts. [Arch Facial Plast Surg 2005](https://doi.org/10.1001/archfaci.7.1.27) · checked 23 September 2026 Specification ## Compound specification | Compound class | Copper-binding tripeptide | | Targets or pathway | Copper binding; tissue remodelling enzymes (from cell and animal work) | | Sequence | Gly-His-Lys, as a copper complex[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/73587) · checked 23 September 2026 | | Molecular formula | Not published | | Molecular weight | Not published | | CAS number | Not published | | PubChem CID | Not published | | Form | Lyophilised powder | | Vial size | 50mg | PubChem records the GHK-copper complex under several formulas, so formula, weight and CAS are not published for the complex. The free tripeptide GHK is PubChem CID 73587. Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 2.5 ml | 20 mg/ml | Injection-protocol reference dilution | | 5.0 ml | 10 mg/ml | Topical formulation base | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for GHK-Cu 50mg](https://www.primaralabs.com/calculator?c=ghk-cu-50mg) Deeper read: [GHK-Cu in the Philippines: the copper peptide, priced](https://www.primaralabs.com/blog/ghk-cu-philippines) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## GHK-Cu batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22GHK-Cu%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [GHK-Cu on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#ghk-cu) Frequently asked ## GHK-Cu questions, answered ### How much does GHK-Cu cost in the Philippines? Primara Labs supplies GHK-Cu in 50mg vials at ₱1,325, or ₱1,190 with the standing 10% off. It is the most accessible compound in the catalogue. ### Is GHK-Cu used for injection or topical research? Both appear in the research literature. The 50mg vial reconstitutes for injection-based protocols at 20 mg/ml, and the powder is also compounded into topical serum and cream bases for dermal formulation research. ### Why is my GHK-Cu solution blue? The blue color is the copper peptide complex itself and is expected. A clear GHK-Cu solution would indicate the copper is missing or the material is degraded. ### Is GHK-Cu in stock with same-day delivery? GHK-Cu 50mg is in stock. Verified Metro Manila orders placed before noon dispatch the same day, and courier delivery reaches Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### How should GHK-Cu vials be stored? Keep lyophilized vials refrigerated at 2 to 8°C and away from light. After reconstitution, refrigerate and use within 28 days. Vials ship in insulated packaging to protect the compound in transit. ### What is GHK-Cu studied for? GHK-Cu is a copper-binding tripeptide found in human plasma. Its human evidence is two small topical trials, one in diabetic foot ulcers from 1994 and one after laser skin resurfacing that found no objective benefit; a 2025 review notes a surprising absence of clinical studies. Most of its literature is cell and animal work. ### What side effects were reported for GHK-Cu? No human adverse event data published (Europe PMC and ClinicalTrials.gov search, 23 September 2026). ### Is GHK-Cu approved in the Philippines? GHK-Cu. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. ### How should GHK-Cu be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for GHK-Cu? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-002 BPC-157 20mg ₱2,390](https://www.primaralabs.com/marketplace/bpc-157-20mg)[PRM-016 GLOW Blend 70mg ₱3,490](https://www.primaralabs.com/marketplace/glow-blend-70mg)[PRM-017 KLOW Blend 80mg ₱3,990](https://www.primaralabs.com/marketplace/klow-blend-80mg)[PRM-008 TB-500 10mg ₱2,390](https://www.primaralabs.com/marketplace/tb-500-10mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about GHK-Cu, answered - [Is GHK-Cu FDA approved?](https://www.primaralabs.com/answers/is-ghk-cu-fda-approved) - [What does GHK-Cu do in research?](https://www.primaralabs.com/answers/what-does-ghk-cu-do-in-research) Research Desk ## GHK-Cu on the Research Desk - [Evidence Map: GHK-Cu (Small human studies)](https://www.primaralabs.com/research/evidence#ghk-cu) - [Regulatory status: GHK-Cu](https://www.primaralabs.com/research/status#ghk-cu) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/cjc-1295-ipamorelin-10mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/cjc-1295-ipamorelin-10mg.md # CJC-1295 / Ipamorelin 5mg + 5mg, Philippines GHRH analog paired with a ghrelin receptor agonist. Studied for growth hormone pulse amplitude. 10% off every order, applied in chat. Presentation Co-lyophilized powder, 5 mg + 5 mg / vial Catalogue code PRM-007 ## Buy by the pack Swipe, up to 50% off Single vial ₱2,390₱2,650 per vial Single vial, ₱2,390 total 1 vial, 10mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱1,775 per vial 5 vials, ₱8,875 total 5 vials, 50mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱1,325 per vial 10 vials, ₱13,250 total 10 vials, 100mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. CJC-1295. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Ipamorelin. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order CJC-1295 / Ipamorelin on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20CJC-1295%20%2F%20Ipamorelin%205mg%20%2B%205mg%20(%E2%82%B12%2C390).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/cjc-1295-ipamorelin). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence CJC-1295[Small human studies](https://www.primaralabs.com/research/evidence#cjc-1295)Ipamorelin[Phase 2 human](https://www.primaralabs.com/research/evidence#ipamorelin) FDA Philippines CJC-1295: [Not published](https://www.primaralabs.com/research/status#cjc-1295)Ipamorelin: [Not published](https://www.primaralabs.com/research/status#ipamorelin) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/strength?ref=pl) Overview ## CJC-1295 / Ipamorelin in the Philippines CJC-1295 and ipamorelin are growth hormone secretagogues studied together for complementary mechanisms: CJC-1295 extends GHRH signaling while ipamorelin provides a selective ghrelin-receptor pulse. The co-formulated blend is the standard configuration in secretagogue research. Primara Labs stocks the blend as a co-lyophilized 5mg + 5mg vial at ₱2,650, or ₱2,390 with the standing 10% off. It is in stock with same-day Metro Manila dispatch on verified orders before noon. Supplied strictly for laboratory research. This vial holds two peptides, 5mg + 5mg, freeze-dried together so there is only one vial to mix. Store it in the fridge before and after reconstitution. The order starts with the WhatsApp button, which writes the product into the chat for you; we reply with availability and the total, and Metro Manila orders confirmed before 12 noon get same-day Metro Manila delivery. How the ipamorelin half of the pair is studied is set out in the [Ipamorelin guide](https://www.philippinespeptides.com/peptides/ipamorelin). ### Research focus - CJC-1295: GHRH analog with drug-affinity complex extending half-life to days. - Ipamorelin: selective ghrelin-receptor agonist studied for clean GH pulses without cortisol or prolactin elevation. - Combination protocols study pulsatile GH release and downstream IGF-1 dynamics. The CJC-1295 / Ipamorelin itself has not been studied. The findings below are for each component on its own. ## Benefits studied: CJC-1295 1. #### Sustained growth hormone and IGF-1 rise Small human studies In two small randomised, placebo-controlled trials in healthy adults aged 21 to 61, one injection of CJC-1295 (DAC form) raised mean growth hormone 2 to 10-fold for 6 days or more and IGF-1 1.5 to 3-fold for 9 to 11 days. [J Clin Endocrinol Metab 2006](https://doi.org/10.1210/jc.2005-1536) · checked 23 September 2026 2. #### Growth hormone pulses preserved Small human studies In a non-randomised study of healthy men aged 20 to 40, one week after CJC-1295 trough growth hormone was 7.5-fold higher and IGF-1 45% higher, while the frequency and size of growth hormone pulses were unchanged. [J Clin Endocrinol Metab 2006](https://doi.org/10.1210/jc.2006-1702) · checked 23 September 2026 3. #### Growth in growth hormone-deficient mice Animal and cell In mice lacking growth hormone-releasing hormone, CJC-1295 treatment over 5 weeks produced normal body weight and length. [Am J Physiol Endocrinol Metab 2006](https://doi.org/10.1152/ajpendo.00201.2006) · checked 23 September 2026 ## Side effects reported: CJC-1295 The two healthy-volunteer trials report no serious adverse reactions; per-event rates are not given in the abstract. [J Clin Endocrinol Metab 2006](https://doi.org/10.1210/jc.2005-1536) · checked 23 September 2026 ## Benefits studied: Ipamorelin 1. #### Gut recovery after bowel surgery (not shown) Phase 2 human In a phase 2 placebo-controlled trial of 117 patients after bowel resection, ipamorelin did not significantly shorten the time to a first tolerated solid meal (median 25.3 against 32.6 hours on placebo). [Int J Colorectal Dis 2014](https://doi.org/10.1007/s00384-014-2030-8) · checked 23 September 2026 2. #### Growth hormone release Small human studies In a dose-escalation study in healthy men without a placebo arm, ipamorelin produced a single growth hormone peak at every dose studied. [Pharm Res 1999](https://doi.org/10.1023/a:1018955126402) · checked 23 September 2026 3. #### Selective growth hormone release Animal and cell In pigs and rat pituitary cells, ipamorelin released growth hormone without raising ACTH or cortisol, unlike the comparison secretagogues. [Eur J Endocrinol 1998](https://doi.org/10.1530/eje.0.1390552) · checked 23 September 2026 ## Side effects reported: Ipamorelin In the phase 2 bowel-surgery trial, any treatment-emergent adverse event occurred in 87.5% on ipamorelin against 94.8% on placebo. [Int J Colorectal Dis 2014](https://doi.org/10.1007/s00384-014-2030-8) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works ### CJC-1295 CJC-1295 is a modified analogue of growth hormone-releasing hormone (GHRH 1-29). The form studied in people carries a reactive group that binds to albumin in the blood, which extends its half-life to several days and gives sustained rises in growth hormone and IGF-1. Targets: GHRH receptor (pituitary) [Source](https://doi.org/10.1152/ajpendo.00201.2006) · checked 23 September 2026 ### Ipamorelin Ipamorelin is a synthetic five-amino-acid growth hormone secretagogue that acts on the ghrelin receptor to release growth hormone from the pituitary. In animal pharmacology it released growth hormone without raising ACTH or cortisol, which is why its developers called it selective. Targets: Ghrelin (GHS) receptor [Source](https://doi.org/10.1530/eje.0.1390552) · checked 23 September 2026 Research ## What the research shows ### CJC-1295 CJC-1295 is a long-acting analogue of growth hormone-releasing hormone. Its human evidence is two small randomised pharmacology trials in healthy adults, published in 2006, that measured growth hormone and IGF-1 rather than a clinical outcome. The human data are for the albumin-binding (DAC) form; no human trial of the form without DAC was found. Animal and cell Human data are two small pharmacology trials of the DAC form; the rest is animal work. - In growth hormone-deficient mice, CJC-1295 restored normal body weight and length. [Am J Physiol Endocrinol Metab 2006](https://doi.org/10.1152/ajpendo.00201.2006) · checked 23 September 2026 - In rats, CJC-1295 gave a larger growth hormone response than GRF(1-29) and stayed in plasma beyond 72 hours. [Endocrinology 2005](https://doi.org/10.1210/en.2004-1286) · checked 23 September 2026 ### Ipamorelin Ipamorelin, a synthetic growth hormone secretagogue, has one completed phase 2 human trial, in patients recovering from bowel resection, and it found no significant difference from placebo. Other human data are pharmacology studies of growth hormone release in healthy men. Most of its literature is animal work. Animal and cell One phase 2 human trial, which found no significant effect; the rest is animal work. - In rat pituitary cells, rats and pigs, ipamorelin released growth hormone without ACTH or cortisol release. [Eur J Endocrinol 1998](https://doi.org/10.1530/eje.0.1390552) · checked 23 September 2026 - In adult female rats, ipamorelin increased longitudinal bone growth over 15 days. [Growth Horm IGF Res 1999](https://doi.org/10.1054/ghir.1999.9998) · checked 23 September 2026 - In a rat model of post-surgical gut slowdown, ipamorelin improved faecal output, food intake and weight gain. [J Pharmacol Exp Ther 2009](https://doi.org/10.1124/jpet.108.149211) · checked 23 September 2026 Specification ## Compound specification ### CJC-1295 | Compound class | Growth hormone-releasing hormone analogue | | Targets or pathway | GHRH receptor (pituitary) | | Sequence | Confirming with supplier | | Molecular formula | Confirming with supplier | | Molecular weight | Confirming with supplier | | CAS number | Confirming with supplier | | PubChem CID | Not published | The name CJC-1295 resolves in PubChem to the albumin-binding (DAC) form, while the catalogue's formula matched the form without DAC. Identity fields are withheld until the supplier confirms which form the vial contains. ### Ipamorelin | Compound class | Growth hormone secretagogue (pentapeptide) | | Targets or pathway | Ghrelin (GHS) receptor | | Sequence | Aib-His-D-2Nal-D-Phe-Lys-NH2[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9831659) · checked 23 September 2026 | | Molecular formula | C38H49N9O5[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9831659) · checked 23 September 2026 | | Molecular weight | 711.9 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9831659) · checked 23 September 2026 | | CAS number | 170851-70-4[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9831659) · checked 23 September 2026 | | PubChem CID | [9831659](https://pubchem.ncbi.nlm.nih.gov/compound/9831659) | | Form | Lyophilised powder | | Vial | Co-lyophilized powder, 5 mg + 5 mg / vial | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 2.0 ml | 5 mg/ml combined | Common reference dilution | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for CJC-1295 / Ipamorelin 5mg + 5mg](https://www.primaralabs.com/calculator?c=cjc-1295-ipamorelin-10mg) Deeper read: [CJC-1295 and Ipamorelin: the GH research pairing](https://www.primaralabs.com/blog/cjc-1295-ipamorelin-philippines) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## CJC-1295 / Ipamorelin batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status ### CJC-1295 FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22CJC-1295%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [CJC-1295 on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#cjc-1295) ### Ipamorelin FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22ipamorelin%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [Ipamorelin on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#ipamorelin) Frequently asked ## CJC-1295 / Ipamorelin questions, answered ### How much does the CJC-1295 Ipamorelin blend cost? The co-lyophilized 5mg + 5mg vial is ₱2,650, or ₱2,390 with the standing 10% off. ### Is the blend currently available? It is in stock. Verified orders placed before noon dispatch the same day across Metro Manila, with insulated courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### Why are the two peptides co-formulated? They act on different receptors in the GH axis, so secretagogue research protocols run them together. Co-lyophilization keeps the 1:1 ratio consistent per vial. ### Has the CJC-1295 / Ipamorelin itself been studied? No. The CJC-1295 / Ipamorelin combines CJC-1295, Ipamorelin in one vial, and the blend itself has not been studied. Each component's evidence is set out separately: CJC-1295, small human studies; Ipamorelin, phase 2 human. ### What is CJC-1295 studied for? CJC-1295 is a long-acting analogue of growth hormone-releasing hormone. Its human evidence is two small randomised pharmacology trials in healthy adults, published in 2006, that measured growth hormone and IGF-1 rather than a clinical outcome. The human data are for the albumin-binding (DAC) form; no human trial of the form without DAC was found. ### What is Ipamorelin studied for? Ipamorelin, a synthetic growth hormone secretagogue, has one completed phase 2 human trial, in patients recovering from bowel resection, and it found no significant difference from placebo. Other human data are pharmacology studies of growth hormone release in healthy men. Most of its literature is animal work. ### What side effects were reported for the CJC-1295 / Ipamorelin components? CJC-1295: The two healthy-volunteer trials report no serious adverse reactions; per-event rates are not given in the abstract. Ipamorelin: In the phase 2 bowel-surgery trial, any treatment-emergent adverse event occurred in 87.5% on ipamorelin against 94.8% on placebo. ### Is CJC-1295 / Ipamorelin approved in the Philippines? CJC-1295. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Ipamorelin. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. ### How should CJC-1295 / Ipamorelin be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for CJC-1295 / Ipamorelin? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-012 Tesamorelin 10mg ₱3,490](https://www.primaralabs.com/marketplace/tesamorelin-10mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about CJC-1295 / Ipamorelin, answered - [Are CJC-1295 and ipamorelin FDA approved?](https://www.primaralabs.com/answers/is-cjc-1295-ipamorelin-fda-approved) - [What is CJC-1295 with ipamorelin?](https://www.primaralabs.com/answers/what-is-cjc-1295-ipamorelin) Research Desk ## CJC-1295 / Ipamorelin on the Research Desk - [Evidence Map: CJC-1295 (Small human studies)](https://www.primaralabs.com/research/evidence#cjc-1295) - [Evidence Map: Ipamorelin (Phase 2 human)](https://www.primaralabs.com/research/evidence#ipamorelin) - [Regulatory status: CJC-1295](https://www.primaralabs.com/research/status#cjc-1295) - [Regulatory status: Ipamorelin](https://www.primaralabs.com/research/status#ipamorelin) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/bac-water-3ml Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/bac-water-3ml.md # Bacteriostatic Water 3ml, Philippines Bacteriostatic water for reconstitution. Benzyl alcohol preserved. 10% off every order, applied in chat. Presentation 3 ml sterile vial, 0.9% benzyl alcohol Catalogue code PRM-005 ## Buy by the pack Swipe, up to 50% off Single vial ₱270₱300 per vial Single vial, ₱270 total 1 x 3ml 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱201 per vial 5 vials, ₱1,005 total 5 x 3ml 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱150 per vial 10 vials, ₱1,500 total 10 x 3ml 10 x 3ml water · 100 syringes · 100 pads Courier is a flat rate per region, on the delivery page. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. Bacteriostatic water is a diluent, not a research compound, and has no row on the Regulatory Status Tracker. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order BAC Water on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20BAC%20Water%203ml%20(%E2%82%B1270).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Overview ## Bacteriostatic Water in the Philippines Bacteriostatic water is sterile water for injection preserved with 0.9% benzyl alcohol, which inhibits microbial growth across repeated draws from the same vial. It is the standard reagent for reconstituting lyophilized peptides in laboratory work. Primara Labs supplies 3ml vials at ₱300, or ₱270 with the standing 10% off, which applies to it as it does to every other item in the catalogue. Most orders add one vial per compound vial they support. A 3ml vial covers one or two reconstitutions. As a reference, reconstituting a 10mg peptide vial typically uses 1 to 2 ml. A sealed 3ml vial of bacteriostatic water can sit at room temperature. Once the stopper has been pierced, move it to the fridge and write the date on the label. Most people add it to a peptide order so it arrives in the same parcel, but it can be ordered alone: tap the WhatsApp button and we confirm the total in the chat. Delivery is same-day Metro Manila delivery, or 1 to 5 business days by region. The [Bacteriostatic water guide](https://www.philippinespeptides.com/guides/bacteriostatic-water-philippines) covers what it is and how it differs from plain sterile water. ### Research focus - 0.9% benzyl alcohol preservation permits multi-draw use over roughly 28 days. - Distinct from sterile water for injection, which is single-use and unpreserved. - Cold storage after first use extends practical working life. ## What bacteriostatic water is used for Bacteriostatic water is sterile water with a small amount of benzyl alcohol added, 0.9%. The benzyl alcohol slows the growth of bacteria, so the same vial can be opened with a needle more than once. Plain sterile water has no preservative and is meant to be used one time only. In a lab, its main job is reconstitution. Many research peptides are shipped as a dry powder, called lyophilised, because a powder stays stable longer than a liquid. Before a peptide can be studied, that powder has to be dissolved. Researchers add the water slowly down the inside wall of the vial, then swirl it gently until the powder is gone. They do not shake it. Storage is simple. Keep sealed vials at room temperature. Once the rubber stopper has been punctured, keep the vial in the fridge, write the date on it, and throw it away after 28 days. Primara Labs supplies bacteriostatic water for laboratory research use only. Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 1 to 2 ml | per 10mg peptide vial | Typical reference usage | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Deeper read: [Bacteriostatic water in the Philippines](https://www.primaralabs.com/blog/bacteriostatic-water-philippines) ### Handling and storage In-use period The US prescribing instructions for tesamorelin, a peptide medicine supplied with bacteriostatic water, say to discard the bacteriostatic water bottle after 28 days of use. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## BAC Water batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Frequently asked ## BAC Water questions, answered ### How much is bacteriostatic water in the Philippines? Primara Labs supplies 3ml bacteriostatic water vials at ₱300. It ships alongside any peptide order with no additional delivery cost. ### Do I need bacteriostatic water with every peptide order? Every lyophilized compound in the catalogue requires reconstitution before research use, so most orders include at least one 3ml vial. Count one vial of water for each compound vial, since 3ml covers one or two reconstitutions. ### Can regular sterile water be used instead? Plain sterile water is unpreserved and intended for single use. Bacteriostatic water contains 0.9% benzyl alcohol so a vial supports repeated draws over roughly 28 days, which is why research protocols specify it. Related compounds [PRM-001 Retatrutide 15mg ₱2,990](https://www.primaralabs.com/marketplace/retatrutide)[PRM-002 BPC-157 20mg ₱2,390](https://www.primaralabs.com/marketplace/bpc-157-20mg)[PRM-004 GHK-Cu 50mg ₱1,190](https://www.primaralabs.com/marketplace/ghk-cu-50mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/mots-c-10mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/mots-c-10mg.md # MOTS-c 10mg, Philippines Mitochondrial-derived peptide. Studied for metabolic and exercise signalling. 10% off every order, applied in chat. Presentation Lyophilized powder, 10 mg / vial Catalogue code PRM-009 ## Buy by the pack Swipe, up to 50% off Single vial ₱1,890₱2,100 per vial Single vial, ₱1,890 total 1 vial, 10mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱1,407 per vial 5 vials, ₱7,035 total 5 vials, 50mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱1,050 per vial 10 vials, ₱10,500 total 10 vials, 100mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. MOTS-c. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order MOTS-c on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20MOTS-c%2010mg%20(%E2%82%B11%2C890).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/mots-c). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Animal and cell](https://www.primaralabs.com/research/evidence#mots-c) FDA Philippines [Not published](https://www.primaralabs.com/research/status#mots-c) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/energy?ref=pl) Overview ## MOTS-c in the Philippines MOTS-c is a 16-residue peptide encoded within mitochondrial DNA, one of the class of mitochondrial-derived peptides discovered over the last decade. Research interest centers on AMPK activation, glucose homeostasis and exercise-mimetic signaling. Primara Labs stocks MOTS-c as a 10mg lyophilized vial at ₱2,100, or ₱1,890 with the standing 10% off. It is in stock with same-day Metro Manila dispatch on verified orders. Supplied strictly for laboratory research use. MOTS-c is packed as a 10mg lyophilised vial. Refrigerate it on arrival, keep it away from light, and keep it cold again after mixing. Buying works through WhatsApp: the button on this page drafts the order, and the reply confirms stock, the peso total and the delivery window. Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. Provincial parcels reach Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. What the mitochondrial research covers is laid out in the [MOTS-c guide](https://www.philippinespeptides.com/peptides/mots-c). ### Research focus - AMPK signaling: MOTS-c translocation to the nucleus under metabolic stress. - Insulin sensitivity: improved glucose handling in rodent models. - Exercise physiology: expression changes with training, studied as an exercise-mimetic candidate. ## Benefits studied 1. #### Insulin sensitivity Animal and cell In mice, MOTS-c prevented insulin resistance linked to age and a high-fat diet, and prevented diet-induced obesity. [Cell Metab 2015](https://doi.org/10.1016/j.cmet.2015.02.009) · checked 23 September 2026 2. #### Physical capacity in old age Animal and cell In mice, MOTS-c treatment started late in life increased physical capacity. [Nat Commun 2021](https://doi.org/10.1038/s41467-020-20790-0) · checked 23 September 2026 3. #### Autoimmune diabetes Animal and cell In non-obese diabetic mice, MOTS-c reduced the development of high blood sugar and immune-cell infiltration of pancreatic islets. [Cell Rep 2021](https://doi.org/10.1016/j.celrep.2021.109447) · checked 23 September 2026 ## Side effects reported No human adverse event data published. [Europe PMC and ClinicalTrials.gov search, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22MOTS-c%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works MOTS-c is a 16-amino-acid peptide encoded in mitochondrial DNA. In mouse and cell studies it acts mainly on skeletal muscle, where it inhibits the folate cycle and linked purine synthesis, which activates the energy sensor AMPK. In people, exercise raises the body's own MOTS-c levels; it has not been given to people in a published study. Targets: Folate cycle and purine synthesis in skeletal muscle, activating AMPK (mouse and cell work) [Source](https://doi.org/10.1016/j.cmet.2015.02.009) · checked 23 September 2026 Research ## What the research shows MOTS-c is a 16-amino-acid peptide encoded in mitochondrial DNA. No published study has given it to people; its evidence is mouse and cell work on insulin sensitivity and physical capacity. A phase 2a human trial was recruiting when checked. Animal and cell Animal and cell studies only. - In mice, MOTS-c prevented insulin resistance linked to age and a high-fat diet, and prevented diet-induced obesity. [Cell Metab 2015](https://doi.org/10.1016/j.cmet.2015.02.009) · checked 23 September 2026 - In mice, MOTS-c treatment started late in life increased physical capacity. [Nat Commun 2021](https://doi.org/10.1038/s41467-020-20790-0) · checked 23 September 2026 - In non-obese diabetic mice, MOTS-c reduced high blood sugar and immune-cell infiltration of pancreatic islets. [Cell Rep 2021](https://doi.org/10.1016/j.celrep.2021.109447) · checked 23 September 2026 Specification ## Compound specification | Compound class | Mitochondrial-derived peptide | | Targets or pathway | Folate cycle and purine synthesis in skeletal muscle, activating AMPK (mouse and cell work) | | Sequence | MRWQEMGYIFYPRKLR[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/146675088) · checked 23 September 2026 | | Molecular formula | C101H152N28O22S2[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/146675088) · checked 23 September 2026 | | Molecular weight | 2174.6 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/146675088) · checked 23 September 2026 | | CAS number | 1627580-64-6[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/146675088) · checked 23 September 2026 | | PubChem CID | [146675088](https://pubchem.ncbi.nlm.nih.gov/compound/146675088) | | Form | Lyophilised powder | | Vial size | 10mg | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 1.0 ml | 10 mg/ml | Highest concentration, smallest volumes | | 2.0 ml | 5 mg/ml | Common reference dilution | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for MOTS-c 10mg](https://www.primaralabs.com/calculator?c=mots-c-10mg) Deeper read: [MOTS-c in the Philippines: the mitochondrial peptide](https://www.primaralabs.com/blog/mots-c-philippines) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## MOTS-c batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22MOTS-c%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [MOTS-c on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#mots-c) Frequently asked ## MOTS-c questions, answered ### How much does MOTS-c cost at Primara Labs? MOTS-c 10mg vials are ₱2,100, or ₱1,890 with the standing 10% off. ### Is MOTS-c currently available? It is in stock. Verified orders placed before noon dispatch the same day across Metro Manila, with insulated courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### What is MOTS-c studied for? Published research covers AMPK activation, glucose homeostasis, insulin sensitivity and exercise-mimetic signaling, mostly in cell and rodent models. ### What side effects were reported for MOTS-c? No human adverse event data published (Europe PMC and ClinicalTrials.gov search, 23 September 2026). ### Is MOTS-c approved in the Philippines? MOTS-c. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. ### How should MOTS-c be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for MOTS-c? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-003 NAD+ 1000mg ₱2,590](https://www.primaralabs.com/marketplace/nad-1000mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about MOTS-c, answered - [Is MOTS-c FDA approved?](https://www.primaralabs.com/answers/is-mots-c-fda-approved) - [What is MOTS-c studied for?](https://www.primaralabs.com/answers/what-is-mots-c-studied-for) Research Desk ## MOTS-c on the Research Desk - [Evidence Map: MOTS-c (Animal and cell)](https://www.primaralabs.com/research/evidence#mots-c) - [Regulatory status: MOTS-c](https://www.primaralabs.com/research/status#mots-c) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/semax-10mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/semax-10mg.md # Semax 10mg, Philippines ACTH fragment analog. Studied for BDNF expression and attention. 10% off every order, applied in chat. Presentation Lyophilized powder, 10 mg / vial Catalogue code PRM-010 ## Buy by the pack Swipe, up to 50% off Single vial ₱1,990₱2,210 per vial Single vial, ₱1,990 total 1 vial, 10mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱1,481 per vial 5 vials, ₱7,405 total 5 vials, 50mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱1,105 per vial 10 vials, ₱11,050 total 10 vials, 100mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. Semax. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order Semax on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20Semax%2010mg%20(%E2%82%B11%2C990).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/semax). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Small human studies](https://www.primaralabs.com/research/evidence#semax) FDA Philippines [Not published](https://www.primaralabs.com/research/status#semax) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/focus?ref=pl) Overview ## Semax in the Philippines Semax is a synthetic heptapeptide derived from the ACTH(4-10) fragment, modified with a Pro-Gly-Pro tail that slows enzymatic breakdown. It carries no corticotropic activity of its own, which is what separated it from the parent fragment in early Russian work and made it a subject of neuropeptide research rather than endocrine research. Published interest centres on BDNF and NGF expression, and on attention and memory endpoints in animal models. The literature is concentrated in Russian-language journals, so English-language systematic review coverage is thinner than the volume of primary work suggests. Primara Labs stocks Semax as a 10mg lyophilized vial at ₱2,210, or ₱1,990 with the standing 10% off. Inventory is held in cold storage inside Metro Manila, so verified orders placed before noon dispatch the same day across the metro, with courier delivery reaches Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. Supplied strictly for laboratory research use. It is not for human consumption, and Primara Labs does not provide medical advice or dosing guidance for people. Semax is supplied dry in a 10mg vial and should be kept in the fridge, sealed, until use. After reconstitution it stays refrigerated. Orders are placed in a WhatsApp chat: the button fills in Semax and the pack size, and we confirm what is in stock and the total before anything is paid. Metro Manila addresses get same-day Metro Manila delivery on orders confirmed before 12 noon. The [Semax guide](https://www.philippinespeptides.com/peptides/semax) explains where the compound came from and how it is studied. ### Research focus - Mechanism: ACTH(4-10) analog with a Pro-Gly-Pro extension, studied without the corticotropic activity of the parent fragment. - Neurotrophic signalling: BDNF and NGF expression changes reported in rodent hippocampal tissue. - Cognition endpoints: attention and memory tasks in animal models, plus human work published largely in Russian-language journals. - Route: studied intranasally as well as by injection, unusual among the peptides in this catalogue. ## Benefits studied 1. #### Recovery after ischaemic stroke Small human studies In a Russian study of 110 patients in rehabilitation after ischaemic stroke, the groups given semax had higher blood BDNF and better improvement on the Barthel index than groups not given it; the abstract does not state how patients were allocated. [Zh Nevrol Psikhiatr 2018](https://doi.org/10.17116/jnevro20181183261-68) · checked 23 September 2026 2. #### Quality of life in motor neuron disease Small human studies In an open-label study of 27 patients with motor neuron disease, semax did not change clinical rating scales but improved total quality-of-life score. [Europe PMC 18379501](https://europepmc.org/article/MED/18379501) · checked 23 September 2026 3. #### Resting brain network activity Small human studies In 24 healthy volunteers, resting-state brain imaging showed a larger default mode network subcomponent within 20 minutes in the 14 given semax than in the 10 given placebo. [Bull Exp Biol Med 2018](https://doi.org/10.1007/s10517-018-4234-3) · checked 23 September 2026 4. #### Brain BDNF signalling Animal and cell In rats, one dose of semax raised hippocampal BDNF protein 1.4-fold and activation of its receptor trkB 1.6-fold. [Brain Res 2006](https://doi.org/10.1016/j.brainres.2006.07.108) · checked 23 September 2026 ## Side effects reported No human adverse event data published. [Europe PMC English-language abstracts, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22semax%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works Semax is a synthetic seven-amino-acid peptide (Met-Glu-His-Phe-Pro-Gly-Pro) derived from a fragment of ACTH. In rats it binds specific sites in the basal forebrain and raises BDNF and its receptor trkB. No defined receptor target in people is reported. Targets: No defined human receptor; BDNF and trkB signalling in rat work [Source](https://doi.org/10.1111/j.1471-4159.2006.03658.x) · checked 23 September 2026 Research ## What the research shows Semax is a synthetic heptapeptide derived from a fragment of ACTH. Its human evidence is small Russian clinical studies, none confirmed as randomised in the abstracts indexed by Europe PMC, mostly in stroke and cerebrovascular disease. Its mechanism is described from rat work on BDNF signalling. Animal and cell Small Russian human studies without confirmed randomisation, and rat work. - In rats, one dose of semax raised hippocampal BDNF protein and trkB activation. [Brain Res 2006](https://doi.org/10.1016/j.brainres.2006.07.108) · checked 23 September 2026 - Semax bound specifically in rat basal forebrain membranes and raised BDNF there within 3 hours. [J Neurochem 2006](https://doi.org/10.1111/j.1471-4159.2006.03658.x) · checked 23 September 2026 - After an induced stroke in rats, semax increased transcription of neurotrophins and their receptors. [Cell Mol Neurobiol 2010](https://doi.org/10.1007/s10571-009-9432-0) · checked 23 September 2026 Specification ## Compound specification | Compound class | ACTH(4-10) analogue heptapeptide | | Targets or pathway | No defined human receptor; BDNF and trkB signalling in rat work | | Sequence | MEHFPGP[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9811102) · checked 23 September 2026 | | Molecular formula | C37H51N9O10S[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9811102) · checked 23 September 2026 | | Molecular weight | 813.9 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9811102) · checked 23 September 2026 | | CAS number | 80714-61-0[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9811102) · checked 23 September 2026 | | PubChem CID | [9811102](https://pubchem.ncbi.nlm.nih.gov/compound/9811102) | | Form | Lyophilised powder | | Vial size | 10mg | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 1.0 ml | 10 mg/ml | Highest concentration, smallest volumes | | 2.0 ml | 5 mg/ml | Common reference dilution | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for Semax 10mg](https://www.primaralabs.com/calculator?c=semax-10mg) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## Semax batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22semax%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [Semax on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#semax) Frequently asked ## Semax questions, answered ### How much does Semax cost at Primara Labs? Semax 10mg vials are ₱2,210, or ₱1,990 with the standing 10% off. ### Is Semax currently available? It is in stock. Verified orders placed before noon dispatch the same day across Metro Manila, with insulated courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### What is Semax studied for? Published research covers BDNF and NGF expression, neuroprotection and attention endpoints, mostly in rodent models and in Russian-language clinical literature. ### What side effects were reported for Semax? No human adverse event data published (Europe PMC English-language abstracts, 23 September 2026). ### Is Semax approved in the Philippines? Semax. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. ### How should Semax be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for Semax? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-011 Selank 10mg ₱1,990](https://www.primaralabs.com/marketplace/selank-10mg)[PRM-015 DSIP 10mg ₱1,990](https://www.primaralabs.com/marketplace/dsip-10mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about Semax, answered - [What is semax studied for?](https://www.primaralabs.com/answers/what-is-semax-studied-for) Research Desk ## Semax on the Research Desk - [Evidence Map: Semax (Small human studies)](https://www.primaralabs.com/research/evidence#semax) - [Regulatory status: Semax](https://www.primaralabs.com/research/status#semax) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/selank-10mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/selank-10mg.md # Selank 10mg, Philippines Tuftsin analog. Studied for anxiolytic signalling without sedation. 10% off every order, applied in chat. Presentation Lyophilized powder, 10 mg / vial Catalogue code PRM-011 ## Buy by the pack Swipe, up to 50% off Single vial ₱1,990₱2,210 per vial Single vial, ₱1,990 total 1 vial, 10mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱1,481 per vial 5 vials, ₱7,405 total 5 vials, 50mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱1,105 per vial 10 vials, ₱11,050 total 10 vials, 100mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. Selank. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order Selank on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20Selank%2010mg%20(%E2%82%B11%2C990).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/selank). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Small human studies](https://www.primaralabs.com/research/evidence#selank) FDA Philippines [Not published](https://www.primaralabs.com/research/status#selank) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/focus?ref=pl) Overview ## Selank in the Philippines Selank is a synthetic heptapeptide built from tuftsin, an immunomodulatory fragment of immunoglobulin G, extended with the same Pro-Gly-Pro tail used in Semax. The extension is what gives it a usable half-life; tuftsin alone degrades too quickly to study. Research attention sits on GABAergic modulation and on the stress response, with the recurring observation in the literature being anxiolytic signalling that does not carry the sedation associated with benzodiazepine-class compounds. That distinction is the reason most of the published work exists. Primara Labs stocks Selank as a 10mg lyophilized vial at ₱2,210, or ₱1,990 with the standing 10% off. It is held in cold storage inside Metro Manila, with same-day metro dispatch on verified orders placed before noon and courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. Supplied strictly for laboratory research use. It is not for human consumption, and Primara Labs does not provide medical advice or dosing guidance for people. Selank ships as a 10mg vial of powder. The storage rule is simple: cold, dark and sealed, between 2 and 8°C, and back in the fridge once mixed. To place an order, tap the WhatsApp button; the message is ready to send, and we answer with availability and a delivery slot. Outside the metro, parcels reach 1 to 2 days Luzon, 2 to 3 Visayas, 3 to 5 Mindanao. For the research background, including how it differs from Semax, read the [Selank guide](https://www.philippinespeptides.com/peptides/selank). ### Research focus - Mechanism: tuftsin analog with a Pro-Gly-Pro extension, studied for GABA-A receptor expression changes. - Anxiolytic signalling: studied specifically for effects reported without the sedation of benzodiazepine-class compounds. - Stress response: monoamine and BDNF changes under induced stress in rodent models. - Shared lineage: the same Pro-Gly-Pro stabilising strategy used in Semax, which is why the two are frequently studied together. ## Benefits studied 1. #### Anxiety symptoms against a benzodiazepine Small human studies In a Russian comparative study of 62 patients with generalised anxiety disorder or neurasthenia, selank and medazepam had similar effects on anxiety rating scales; there was no placebo arm and the abstract does not state how patients were allocated. [Europe PMC 18454096](https://europepmc.org/article/MED/18454096) · checked 23 September 2026 2. #### Benzodiazepine side effects as an add-on Small human studies In a Russian study of 70 patients with anxiety-spectrum disorders, adding selank to phenazepam was reported to reduce phenazepam side effects compared with phenazepam alone; there was no placebo arm. [Zh Nevrol Psikhiatr 2015](https://doi.org/10.17116/jnevro20151156133-40) · checked 23 September 2026 3. #### GABA receptor modulation Animal and cell In receptor binding assays on brain cell membranes, selank acted as a positive allosteric modulator of GABA binding. [Protein Pept Lett 2018](https://doi.org/10.2174/0929866525666180925144642) · checked 23 September 2026 4. #### Enkephalinase inhibition Animal and cell In human plasma in the test tube, selank inhibited the breakdown of enkephalins in a dose-dependent way. [Bull Exp Biol Med 2001](https://doi.org/10.1023/a:1017979514274) · checked 23 September 2026 ## Side effects reported No human adverse event data published. [Europe PMC English-language abstracts, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22selank%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works Selank is a synthetic seven-amino-acid peptide (Thr-Lys-Pro-Arg-Pro-Gly-Pro). Laboratory and rat studies propose two mechanisms, allosteric modulation of GABA receptors and inhibition of the enzymes that break down enkephalins. Neither has been confirmed in human pharmacology studies. Targets: Proposed GABA receptor modulation and enkephalinase inhibition (laboratory work) [Source](https://doi.org/10.2174/0929866525666180925144642) · checked 23 September 2026 Research ## What the research shows Selank is a synthetic heptapeptide studied in Russia for anxiety disorders. Its human evidence is small comparative studies against benzodiazepines without a placebo arm or stated random allocation. Its proposed mechanisms, GABA receptor modulation and enkephalinase inhibition, come from laboratory work. Animal and cell Small Russian human studies without a placebo arm, and laboratory work. - In receptor binding work, selank acted as a positive allosteric modulator of GABA binding. [Protein Pept Lett 2018](https://doi.org/10.2174/0929866525666180925144642) · checked 23 September 2026 - In rat frontal cortex, selank changed the expression of 45 of 84 neurotransmission genes within an hour. [Front Pharmacol 2016](https://doi.org/10.3389/fphar.2016.00031) · checked 23 September 2026 - In human plasma in the test tube, selank inhibited the enzymes that break down enkephalins. [Bull Exp Biol Med 2001](https://doi.org/10.1023/a:1017979514274) · checked 23 September 2026 Specification ## Compound specification | Compound class | Synthetic heptapeptide | | Targets or pathway | Proposed GABA receptor modulation and enkephalinase inhibition (laboratory work) | | Sequence | TKPRPGP[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/11765600) · checked 23 September 2026 | | Molecular formula | C33H57N11O9[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/11765600) · checked 23 September 2026 | | Molecular weight | 751.9 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/11765600) · checked 23 September 2026 | | CAS number | 129954-34-3[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/11765600) · checked 23 September 2026 | | PubChem CID | [11765600](https://pubchem.ncbi.nlm.nih.gov/compound/11765600) | | Form | Lyophilised powder | | Vial size | 10mg | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 1.0 ml | 10 mg/ml | Highest concentration, smallest volumes | | 2.0 ml | 5 mg/ml | Common reference dilution | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for Selank 10mg](https://www.primaralabs.com/calculator?c=selank-10mg) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## Selank batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22selank%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [Selank on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#selank) Frequently asked ## Selank questions, answered ### How much does Selank cost at Primara Labs? Selank 10mg vials are ₱2,210, or ₱1,990 with the standing 10% off. ### Is Selank currently available? It is in stock. Verified orders placed before noon dispatch the same day across Metro Manila, with insulated courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### How does Selank differ from Semax? Both use the same Pro-Gly-Pro stabilising extension, but Selank derives from tuftsin and is studied for GABAergic and stress-response signalling, while Semax derives from an ACTH fragment and is studied for BDNF expression and attention. ### What is Selank studied for? Selank is a synthetic heptapeptide studied in Russia for anxiety disorders. Its human evidence is small comparative studies against benzodiazepines without a placebo arm or stated random allocation. Its proposed mechanisms, GABA receptor modulation and enkephalinase inhibition, come from laboratory work. ### What side effects were reported for Selank? No human adverse event data published (Europe PMC English-language abstracts, 23 September 2026). ### Is Selank approved in the Philippines? Selank. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. ### How should Selank be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for Selank? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-010 Semax 10mg ₱1,990](https://www.primaralabs.com/marketplace/semax-10mg)[PRM-015 DSIP 10mg ₱1,990](https://www.primaralabs.com/marketplace/dsip-10mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about Selank, answered - [What is selank studied for?](https://www.primaralabs.com/answers/what-is-selank-studied-for) Research Desk ## Selank on the Research Desk - [Evidence Map: Selank (Small human studies)](https://www.primaralabs.com/research/evidence#selank) - [Regulatory status: Selank](https://www.primaralabs.com/research/status#selank) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/tesamorelin-10mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/tesamorelin-10mg.md # Tesamorelin 10mg, stocked in the Philippines GHRH analog. Studied for visceral adipose tissue endpoints. 10% off every order, applied in chat. Presentation Lyophilized powder, 10 mg / vial Catalogue code PRM-012 ## Buy by the pack Swipe, up to 50% off Single vial ₱3,490₱3,875 per vial Single vial, ₱3,490 total 1 vial, 10mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱2,596 per vial 5 vials, ₱12,980 total 5 vials, 50mg total 5 x 3ml water · 50 syringes · 50 pads Free courier at this total, anywhere in the Philippines. Best value 10 pack · 50% off list ₱1,938 per vial 10 vials, ₱19,380 total 10 vials, 100mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. Tesamorelin. FDA Philippines: not established. US FDA: Approved for reduction of excess abdominal fat in HIV-infected adult patients with lipodystrophy. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order Tesamorelin on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20Tesamorelin%2010mg%20(%E2%82%B13%2C490).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/tesamorelin). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Phase 3 human](https://www.primaralabs.com/research/evidence#tesamorelin) FDA Philippines [Not published](https://www.primaralabs.com/research/status#tesamorelin) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/strength?ref=pl) Overview ## Tesamorelin in the Philippines Tesamorelin is a stabilised analog of growth hormone releasing hormone, specifically a trans-3-hexenoyl modification of GRF(1-44). The acyl group slows degradation by dipeptidyl peptidase-4, which is the difference between a research-usable compound and one that clears in minutes. It has the most substantial regulatory trial record of any GHRH analog in this catalogue, with published work concentrated on visceral adipose tissue endpoints and on downstream IGF-1 signalling. Unlike a direct growth hormone, it acts on the pituitary and so the resulting secretion retains its pulsatile pattern, which is the mechanistic point most of the literature turns on. Primara Labs stocks Tesamorelin as a 10mg lyophilized vial at ₱3,875, or ₱3,490 with the standing 10% off. Inventory sits in cold storage inside Metro Manila, so there is no international shipping leg and no customs exposure on an order. Supplied strictly for laboratory research use. It is not for human consumption, and Primara Labs does not provide medical advice or dosing guidance for people. ### Research focus - Mechanism: trans-3-hexenoyl GRF(1-44), a GHRH analog stabilised against DPP-4 degradation. - Visceral adipose tissue: the primary published endpoint, measured by CT in the registrational trial programme. - IGF-1: downstream signalling studied as the marker of pituitary response. - Pulsatility: acts at the pituitary rather than supplying growth hormone directly, so secretion pattern is preserved. ## Benefits studied 1. #### Visceral fat reduction Phase 3 human In a 26-week phase 3 trial of 412 adults with HIV and abdominal fat accumulation, visceral fat measured by CT fell 15.2% on tesamorelin and rose 5.0% on placebo. [Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3)](https://doi.org/10.1056/NEJMoa072375) · checked 23 September 2026 2. #### Triglyceride reduction Phase 3 human In a pooled analysis of the two 26-week phase 3 trials (806 adults with HIV and excess abdominal fat), triglycerides fell 37 mg per decilitre on tesamorelin and rose 6 mg per decilitre on placebo. [Pooled phase 3 analysis, J Clin Endocrinol Metab 2010](https://doi.org/10.1210/jc.2010-0490) · checked 23 September 2026 3. #### Cognition in older adults Phase 2 human In a 20-week phase 2 trial of 152 adults aged 55 to 87, some with mild cognitive impairment, the intent-to-treat analysis showed a favourable effect on a cognitive composite, mainly executive function; two later trials in other groups did not show a significant effect. [Arch Neurol 2012](https://doi.org/10.1001/archneurol.2012.1970) · checked 23 September 2026 4. #### Liver fat reduction Small human studies In a 12-month randomised, placebo-controlled trial of 61 people with HIV and fatty liver disease, with no phase stated, tesamorelin reduced liver fat fraction by an absolute 4.1 percentage points more than placebo. [Lancet HIV 2019](https://doi.org/10.1016/s2352-3018(19)30338-8) · checked 23 September 2026 ## Side effects reported The abstract reports that adverse events did not differ significantly between groups, but that more participants on tesamorelin withdrew because of an adverse event; it gives no rates. [Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3)](https://doi.org/10.1056/NEJMoa072375) · checked 23 September 2026 In a 20-week phase 2 trial in older adults, mild adverse events were reported by 68% on tesamorelin against 36% on placebo. [Arch Neurol 2012](https://doi.org/10.1001/archneurol.2012.1970) · checked 23 September 2026 In a 6-month trial of 50 people with HIV, fasting glucose rose 9 mg per decilitre on tesamorelin against 2 on placebo at 2 weeks; the difference was not significant at 6 months. [JAMA 2014](https://doi.org/10.1001/jama.2014.8334) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works Tesamorelin is a synthetic analogue of growth hormone-releasing factor (GHRH 1-44). It acts on the pituitary to increase basal and pulsatile growth hormone secretion, which in turn raises IGF-1. Targets: GHRH receptor (pituitary) [Source](https://doi.org/10.1007/s40262-014-0202-x) · checked 23 September 2026 Research ## What the research shows Tesamorelin, a synthetic analogue of growth hormone-releasing factor, has two completed phase 3 trials in adults with HIV and excess abdominal fat, published in 2007 and 2010. The Research Desk evidence pass identified ten completed human randomised controlled trials in all. A cognition result in older adults was not repeated in two later trials. [Tesamorelin phase 3 (Falutz, NEJM 2007)](https://www.primaralabs.com/research/trials/tesamorelin-phase-3-2007) In Tesamorelin phase 3 (Falutz, NEJM 2007), a phase 3 trial of tesamorelin in adults with HIV and abdominal fat accumulation (86% men) (n=412), the visceral adipose tissue was -15.2% on 2 mg over 26 weeks, against +5.0% on placebo (Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3)). Tesamorelin phase 3 (Falutz, NEJM 2007): The abstract reports that adverse events did not differ significantly between groups, but that more participants on tesamorelin withdrew because of an adverse event; it gives no rates. Specification ## Compound specification | Compound class | Growth hormone-releasing factor analogue | | Targets or pathway | GHRH receptor (pituitary) | | Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, with an N-terminal trans-3-hexenoyl group[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/16137828) · checked 23 September 2026 | | Molecular formula | C221H366N72O67S[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/16137828) · checked 23 September 2026 | | Molecular weight | 5136 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/16137828) · checked 23 September 2026 | | CAS number | 218949-48-5[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/16137828) · checked 23 September 2026 | | PubChem CID | [16137828](https://pubchem.ncbi.nlm.nih.gov/compound/16137828) | | Form | Lyophilised powder | | Vial size | 10mg | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 1.0 ml | 10 mg/ml | Highest concentration, smallest volumes | | 2.0 ml | 5 mg/ml | Common reference dilution | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-30ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for Tesamorelin 10mg](https://www.primaralabs.com/calculator?c=tesamorelin-10mg) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## Tesamorelin batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA Approved for reduction of excess abdominal fat in HIV-infected adult patients with lipodystrophy Drugs@FDA: Egrifta (BLA022505, approved 10 November 2010). The approval covers the named branded medicine for its labelled use only, never a research-grade vial of the same substance. [Source](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=022505) · checked 23 September 2026 EMA Not approved The application for Egrifta (EMEA/H/C/002427) was withdrawn on 21 June 2012; no marketing authorisation was granted. [Source](https://www.ema.europa.eu/en/medicines/human/EPAR/egrifta) · checked 23 September 2026 Sponsor's next milestone Not published None sought: an approved medicine already exists. Not published [Tesamorelin on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#tesamorelin) Frequently asked ## Tesamorelin questions, answered ### How much does Tesamorelin cost at Primara Labs? Tesamorelin 10mg vials are ₱3,875, or ₱3,490 with the standing 10% off. ### Is Tesamorelin currently available? It is in stock. Verified orders placed before noon dispatch the same day across Metro Manila, with insulated courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### How does Tesamorelin differ from CJC-1295 with Ipamorelin? Tesamorelin is a single GHRH analog. The CJC-1295 and Ipamorelin blend pairs a GHRH analog with a ghrelin receptor agonist, so it acts on two pathways rather than one. Both are studied at the pituitary rather than supplying growth hormone directly. ### What is Tesamorelin studied for? Tesamorelin, a synthetic analogue of growth hormone-releasing factor, has two completed phase 3 trials in adults with HIV and excess abdominal fat, published in 2007 and 2010. The Research Desk evidence pass identified ten completed human randomised controlled trials in all. A cognition result in older adults was not repeated in two later trials. ### What side effects were reported for Tesamorelin? The abstract reports that adverse events did not differ significantly between groups, but that more participants on tesamorelin withdrew because of an adverse event; it gives no rates. In a 20-week phase 2 trial in older adults, mild adverse events were reported by 68% on tesamorelin against 36% on placebo. In a 6-month trial of 50 people with HIV, fasting glucose rose 9 mg per decilitre on tesamorelin against 2 on placebo at 2 weeks; the difference was not significant at 6 months. ### Is Tesamorelin approved in the Philippines? Tesamorelin. FDA Philippines: not established. US FDA: Approved for reduction of excess abdominal fat in HIV-infected adult patients with lipodystrophy. Checked 23 September 2026. ### How should Tesamorelin be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for Tesamorelin? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-007 CJC-1295 / Ipamorelin 5mg + 5mg ₱2,390](https://www.primaralabs.com/marketplace/cjc-1295-ipamorelin-10mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about Tesamorelin, answered - [Is tesamorelin FDA approved?](https://www.primaralabs.com/answers/is-tesamorelin-fda-approved) - [What did the tesamorelin trials find?](https://www.primaralabs.com/answers/what-did-tesamorelin-trials-find) Research Desk ## Tesamorelin on the Research Desk - [Evidence Map: Tesamorelin (Phase 3 human)](https://www.primaralabs.com/research/evidence#tesamorelin) - [Trial: Tesamorelin phase 3 (Falutz, NEJM 2007)](https://www.primaralabs.com/research/trials/tesamorelin-phase-3-2007) - [Regulatory status: Tesamorelin](https://www.primaralabs.com/research/status#tesamorelin) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/pt-141-10mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/pt-141-10mg.md # PT-141 10mg, Philippines Melanocortin receptor agonist. Studied for central rather than vascular pathways. 10% off every order, applied in chat. Presentation Lyophilized powder, 10 mg / vial Catalogue code PRM-014 ## Buy by the pack Swipe, up to 50% off Single vial ₱1,790₱1,990 per vial Single vial, ₱1,790 total 1 vial, 10mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱1,333 per vial 5 vials, ₱6,665 total 5 vials, 50mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱995 per vial 10 vials, ₱9,950 total 10 vials, 100mg total 10 x 3ml water · 100 syringes · 100 pads Courier is a flat rate per region, on the delivery page. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. Bremelanotide. FDA Philippines: not established. US FDA: Approved for acquired, generalized hypoactive sexual desire disorder (HSDD) in premenopausal women. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order PT-141 on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20PT-141%2010mg%20(%E2%82%B11%2C790).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/pt-141). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Phase 3 human](https://www.primaralabs.com/research/evidence#bremelanotide) FDA Philippines [Not published](https://www.primaralabs.com/research/status#bremelanotide) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Overview ## PT-141 in the Philippines PT-141, also written as bremelanotide, is a cyclic seven-residue melanocortin receptor agonist derived from the alpha-MSH analog melanotan II. Removing the amide group changed the pigmentation profile of the parent compound and shifted research attention to melanocortin receptor signalling instead. The published work is distinguished from earlier compounds in the same research area by acting on central melanocortin pathways rather than on vascular smooth muscle. MC4R is the receptor subtype most of the literature concentrates on. Primara Labs stocks PT-141 as a 10mg lyophilized vial at ₱1,990, or ₱1,790 with the standing 10% off. It is held in cold storage inside Metro Manila, with same-day metro dispatch on verified orders placed before noon. Supplied strictly for laboratory research use. It is not for human consumption, and Primara Labs does not provide medical advice or dosing guidance for people. PT-141 is sold here as a 10mg lyophilised vial. Store it cold and in its box, away from light, both before and after mixing. The WhatsApp button on this page starts the order with the product already named; we reply with stock and the peso total, then book the delivery. Orders confirmed before 12 noon get same-day Metro Manila delivery. More on the melanocortin research is in the [PT-141 guide](https://www.philippinespeptides.com/peptides/pt141). ### Research focus - Mechanism: cyclic melanocortin receptor agonist, studied principally at MC4R. - Pathway: central rather than vascular, which is the distinction from earlier compounds studied in the same research area. - Lineage: derived from melanotan II by removal of the amide group, which altered the pigmentation profile. - Reported effects in the literature include flushing and nausea in a dose-related pattern. ## Benefits studied 1. #### Sexual desire in premenopausal women Phase 3 human In RECONNECT (studies 301 and 302), two 24-week phase 3 trials in 1,267 premenopausal women with hypoactive sexual desire disorder, the FSFI desire score improved by 0.30 and 0.42 points more than placebo. [Kingsberg SA et al. Obstet Gynecol 2019 (RECONNECT)](https://doi.org/10.1097/AOG.0000000000003500) · checked 23 September 2026 2. #### Distress about low desire Phase 3 human In the same two phase 3 trials, distress related to low sexual desire (FSDS-DAO item 13) fell 0.37 and 0.29 points more than placebo. [Kingsberg SA et al. Obstet Gynecol 2019 (RECONNECT)](https://doi.org/10.1097/AOG.0000000000003500) · checked 23 September 2026 3. #### Satisfying sexual events Phase 2 human In a 12-week phase 2b dose-finding trial in premenopausal women with female sexual dysfunction (efficacy population 327), satisfying sexual events rose by 0.7 a month on the pooled higher-dose arms against 0.2 on placebo. [Womens Health (Lond) 2016](https://doi.org/10.2217/whe-2016-0018) · checked 23 September 2026 4. #### Short-term body weight Small human studies In a 16-day phase 1 placebo-controlled trial in women with obesity, body weight fell 1.3 kg more on bremelanotide than on placebo. [Diabetes Obes Metab 2022](https://doi.org/10.1111/dom.14672) · checked 23 September 2026 ## Side effects reported The most frequently reported adverse events were nausea in 40.0% on 1.75 mg, integrated phase 3 against 1.3% on placebo, flushing in 20.3% on 1.75 mg, integrated phase 3 against 1.3% on placebo, headache in 11.3% on 1.75 mg, integrated phase 3 against 1.9% on placebo and injection site reactions in 5.4% on 1.75 mg, integrated phase 3 against 0.5% on placebo (Safety profile across the clinical programme, J Womens Health 2022 (integrated double-blind phase 3, N=1,247)). The safety review reports nausea as the most common reason for stopping bremelanotide, without a rate. [Safety profile across the clinical programme, J Womens Health 2022 (integrated double-blind phase 3, N=1,247)](https://doi.org/10.1089/jwh.2021.0191) · checked 23 September 2026 Across the development programme, focal skin darkening was rare at labelled use but occurred in more than a third of people given up to 16 consecutive daily doses, and small, transient blood pressure rises were seen on ambulatory monitoring. [J Womens Health 2022](https://doi.org/10.1089/jwh.2021.0191) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works Bremelanotide is a synthetic peptide analogue of alpha-melanocyte-stimulating hormone that acts as an agonist at melanocortin receptors, chiefly MC3R and MC4R. Investigators link MC4R agonism to its effects on sexual desire; MC4R also regulates appetite, which is why it was studied for food intake. Targets: Melanocortin receptors, chiefly MC3R and MC4R [Source](https://doi.org/10.1111/j.1743-6109.2006.00268.x) · checked 23 September 2026 Research ## What the research shows Bremelanotide (sold as PT-141) is a melanocortin receptor agonist with two completed phase 3 trials, RECONNECT 301 and 302, in 1,267 premenopausal women with hypoactive sexual desire disorder, published in 2019. The evidence pass identified nine completed human randomised controlled trials. A trial in men with erectile dysfunction carries a published expression of concern and is not counted. [RECONNECT (studies 301 and 302)](https://www.primaralabs.com/research/trials/reconnect) In RECONNECT (studies 301 and 302), a phase 3 trial of bremelanotide in premenopausal women with hypoactive sexual desire disorder (n=1,267), the FSFI desire domain score difference from placebo was +0.30 points on study 301, 1.75 mg and +0.42 points on study 302, 1.75 mg over 24 weeks (Kingsberg SA et al. Obstet Gynecol 2019 (RECONNECT)). The most frequently reported adverse events were nausea in 40.0% on 1.75 mg, integrated phase 3 against 1.3% on placebo, flushing in 20.3% on 1.75 mg, integrated phase 3 against 1.3% on placebo, headache in 11.3% on 1.75 mg, integrated phase 3 against 1.9% on placebo and injection site reactions in 5.4% on 1.75 mg, integrated phase 3 against 0.5% on placebo (Safety profile across the clinical programme, J Womens Health 2022 (integrated double-blind phase 3, N=1,247)). The safety review reports nausea as the most common reason for stopping bremelanotide, without a rate. Specification ## Compound specification | Compound class | Melanocortin receptor agonist (cyclic heptapeptide) | | Targets or pathway | Melanocortin receptors, chiefly MC3R and MC4R | | Sequence | Ac-Nle-cyclo\[Asp-His-D-Phe-Arg-Trp-Lys\]-OH[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941379) · checked 23 September 2026 | | Molecular formula | C50H68N14O10[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941379) · checked 23 September 2026 | | Molecular weight | 1025.2 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941379) · checked 23 September 2026 | | CAS number | 189691-06-3[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941379) · checked 23 September 2026 | | PubChem CID | [9941379](https://pubchem.ncbi.nlm.nih.gov/compound/9941379) | | Form | Lyophilised powder | | Vial size | 10mg | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 1.0 ml | 10 mg/ml | Highest concentration, smallest volumes | | 2.0 ml | 5 mg/ml | Common reference dilution | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for PT-141 10mg](https://www.primaralabs.com/calculator?c=pt-141-10mg) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## PT-141 batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA Approved for acquired, generalized hypoactive sexual desire disorder (HSDD) in premenopausal women Drugs@FDA: Vyleesi (NDA210557, approved 21 June 2019). The approval covers the named branded medicine for its labelled use only, never a research-grade vial of the same substance. [Source](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=210557) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published None sought: an approved medicine already exists. Not published [Bremelanotide on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#bremelanotide) Frequently asked ## PT-141 questions, answered ### How much does PT-141 cost at Primara Labs? PT-141 10mg vials are ₱1,990, or ₱1,790 with the standing 10% off. ### Is PT-141 currently available? It is in stock. Verified orders placed before noon dispatch the same day across Metro Manila, with insulated courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### How does PT-141 relate to melanotan II? PT-141 is derived from melanotan II by removal of the amide group. That change altered the pigmentation profile of the parent compound and moved research attention to central melanocortin receptor signalling. ### What is Bremelanotide studied for? Bremelanotide (sold as PT-141) is a melanocortin receptor agonist with two completed phase 3 trials, RECONNECT 301 and 302, in 1,267 premenopausal women with hypoactive sexual desire disorder, published in 2019. The evidence pass identified nine completed human randomised controlled trials. A trial in men with erectile dysfunction carries a published expression of concern and is not counted. ### What side effects were reported for PT-141? The most frequently reported adverse events were nausea in 40.0% on 1.75 mg, integrated phase 3 against 1.3% on placebo, flushing in 20.3% on 1.75 mg, integrated phase 3 against 1.3% on placebo, headache in 11.3% on 1.75 mg, integrated phase 3 against 1.9% on placebo and injection site reactions in 5.4% on 1.75 mg, integrated phase 3 against 0.5% on placebo (Safety profile across the clinical programme, J Womens Health 2022 (integrated double-blind phase 3, N=1,247)). The safety review reports nausea as the most common reason for stopping bremelanotide, without a rate. Across the development programme, focal skin darkening was rare at labelled use but occurred in more than a third of people given up to 16 consecutive daily doses, and small, transient blood pressure rises were seen on ambulatory monitoring. ### Is PT-141 approved in the Philippines? Bremelanotide. FDA Philippines: not established. US FDA: Approved for acquired, generalized hypoactive sexual desire disorder (HSDD) in premenopausal women. Checked 23 September 2026. ### How should PT-141 be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for PT-141? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-010 Semax 10mg ₱1,990](https://www.primaralabs.com/marketplace/semax-10mg)[PRM-011 Selank 10mg ₱1,990](https://www.primaralabs.com/marketplace/selank-10mg)[PRM-005 BAC Water 3ml ₱270](https://www.primaralabs.com/marketplace/bac-water-3ml) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about PT-141, answered - [Is PT-141 FDA approved?](https://www.primaralabs.com/answers/is-pt-141-fda-approved) - [How does PT-141 work?](https://www.primaralabs.com/answers/how-does-pt-141-work) Research Desk ## PT-141 on the Research Desk - [Evidence Map: Bremelanotide (Phase 3 human)](https://www.primaralabs.com/research/evidence#bremelanotide) - [Trial: RECONNECT (studies 301 and 302)](https://www.primaralabs.com/research/trials/reconnect) - [Regulatory status: Bremelanotide](https://www.primaralabs.com/research/status#bremelanotide) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/dsip-10mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/dsip-10mg.md # DSIP 10mg, Philippines Delta sleep-inducing peptide. Studied for slow-wave sleep architecture. 10% off every order, applied in chat. Presentation Lyophilized powder, 10 mg / vial Catalogue code PRM-015 ## Buy by the pack Swipe, up to 50% off Single vial ₱1,990₱2,210 per vial Single vial, ₱1,990 total 1 vial, 10mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 33% off list ₱1,481 per vial 5 vials, ₱7,405 total 5 vials, 50mg total 5 x 3ml water · 50 syringes · 50 pads Courier is a flat rate per region, on the delivery page. Best value 10 pack · 50% off list ₱1,105 per vial 10 vials, ₱11,050 total 10 vials, 100mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. DSIP. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order DSIP on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20DSIP%2010mg%20(%E2%82%B11%2C990).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/dsip). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence [Small human studies](https://www.primaralabs.com/research/evidence#dsip) FDA Philippines [Not published](https://www.primaralabs.com/research/status#dsip) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/sleep?ref=pl) Overview ## DSIP in the Philippines DSIP is a nine-residue peptide first isolated from rabbit cerebral venous blood during slow-wave sleep, which is where the name comes from. It is one of the older compounds in this catalogue by date of discovery and one of the less well characterised by mechanism. Published research covers sleep architecture, particularly slow-wave distribution, alongside hypothalamic signalling and stress adaptation endpoints. A specific receptor has never been definitively identified, which is the main reason the mechanistic literature remains unsettled decades after isolation. Primara Labs stocks DSIP as a 10mg lyophilized vial at ₱2,210, or ₱1,990 with the standing 10% off. It is held in cold storage inside Metro Manila with same-day metro dispatch on verified orders placed before noon. Supplied strictly for laboratory research use. It is not for human consumption, and Primara Labs does not provide medical advice or dosing guidance for people. DSIP, short for delta sleep-inducing peptide, is supplied as a 10mg vial. It is a small, fragile peptide, so it is kept refrigerated and away from light, and once mixed it stays in the fridge. To buy it, message us through the WhatsApp button; the chat carries the order, and we confirm the total and a delivery time there. Parcels outside Metro Manila reach Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. The [DSIP guide](https://www.philippinespeptides.com/peptides/dsip) explains what is and is not known about it. ### Research focus - Mechanism: no specific receptor definitively identified, which is why the mechanistic picture remains open. - Sleep architecture: slow-wave distribution is the endpoint the compound was named for and the one most studied. - Hypothalamic signalling: corticotropin and somatotropin interactions reported in animal models. - Stress adaptation: studied alongside sleep endpoints rather than separately from them. ## Benefits studied 1. #### Sleep in chronic insomnia (weak, mixed) Small human studies In a 1992 placebo-controlled study of 16 people with chronic insomnia, sleep efficiency was higher and sleep onset shorter than on placebo, but the authors judged the effects weak and not of major therapeutic benefit. [Neuropsychobiology 1992](https://doi.org/10.1159/000118919) · checked 23 September 2026 2. #### Daytime sleep in healthy volunteers Small human studies In a 1981 placebo-controlled crossover study of 6 healthy volunteers, total sleep time in the following 130 minutes rose by a median 59% compared with placebo. [Europe PMC 6895513](https://europepmc.org/article/MED/6895513) · checked 23 September 2026 3. #### ACTH levels (inconsistent) Small human studies In a randomised crossover study of 11 healthy men, DSIP lowered blood ACTH-like activity for at least 3 hours with no change in cortisol; a 1995 placebo-controlled study found no effect on ACTH or cortisol. [Psychoneuroendocrinology 1989](https://doi.org/10.1016/0306-4530(89)90004-8) · checked 23 September 2026 ## Side effects reported In a small randomised study during anaesthesia, DSIP was associated with a higher heart rate and lighter anaesthetic depth than saline; the size of the change is not given in the abstract. [Eur J Anaesthesiol 2009](https://doi.org/10.1097/eja.0b013e32831c8644) · checked 23 September 2026 An uncontrolled 1984 series of withdrawal patients reported headache in a few patients, without a rate. [Eur Neurol 1984](https://doi.org/10.1159/000115715) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works Delta sleep-inducing peptide is a nine-amino-acid peptide first isolated from rabbit blood in 1977. No gene, precursor protein or receptor for it has been identified, so its mechanism of action is unknown, and a 2006 review describes its link to sleep as poorly characterised. Targets: Unknown; no gene, precursor or receptor identified [Source](https://doi.org/10.1111/j.1471-4159.2006.03693.x) · checked 23 September 2026 Research ## What the research shows Delta sleep-inducing peptide is a nine-residue peptide with no identified gene, precursor or receptor, so its mechanism is unknown. Its human evidence is small studies from 1981 to 2009, with sleep results its own authors described as weak and conflicting. Animal and cell Small human studies from 1981 to 2009 with mixed results, and rat work. - In rats with restricted blood flow to the brain, DSIP reduced posture problems and deaths. [Neurosci Behav Physiol 1998](https://doi.org/10.1007/bf02464804) · checked 23 September 2026 - In rats, DSIP and an analogue reduced the incidence and duration of induced seizures. [Seizure 2005](https://doi.org/10.1016/j.seizure.2005.02.001) · checked 23 September 2026 Specification ## Compound specification | Compound class | Nonapeptide | | Targets or pathway | Unknown; no gene, precursor or receptor identified | | Sequence | WAGGDASGE[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/68816) · checked 23 September 2026 | | Molecular formula | C35H48N10O15[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/68816) · checked 23 September 2026 | | Molecular weight | 848.8 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/68816) · checked 23 September 2026 | | CAS number | Not published | | PubChem CID | [68816](https://pubchem.ncbi.nlm.nih.gov/compound/68816) | | Form | Lyophilised powder | | Vial size | 10mg | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 1.0 ml | 10 mg/ml | Highest concentration, smallest volumes | | 2.0 ml | 5 mg/ml | Common reference dilution | | 4.0 ml | 2.5 mg/ml | Larger volumes, finer graduation | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for DSIP 10mg](https://www.primaralabs.com/calculator?c=dsip-10mg) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## DSIP batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22delta%20sleep-inducing%20peptide%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [DSIP on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#dsip) Frequently asked ## DSIP questions, answered ### How much does DSIP cost at Primara Labs? DSIP 10mg vials are ₱2,210, or ₱1,990 with the standing 10% off. ### Is DSIP currently available? It is in stock. Verified orders placed before noon dispatch the same day across Metro Manila, with insulated courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. ### What is DSIP studied for? Published research covers slow-wave sleep architecture, hypothalamic signalling and stress adaptation. No specific receptor has been definitively identified, so the mechanistic literature remains unsettled. ### What side effects were reported for DSIP? In a small randomised study during anaesthesia, DSIP was associated with a higher heart rate and lighter anaesthetic depth than saline; the size of the change is not given in the abstract. An uncontrolled 1984 series of withdrawal patients reported headache in a few patients, without a rate. ### Is DSIP approved in the Philippines? DSIP. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. ### How should DSIP be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for DSIP? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-010 Semax 10mg ₱1,990](https://www.primaralabs.com/marketplace/semax-10mg)[PRM-011 Selank 10mg ₱1,990](https://www.primaralabs.com/marketplace/selank-10mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about DSIP, answered - [What is DSIP studied for?](https://www.primaralabs.com/answers/what-is-dsip-studied-for) Research Desk ## DSIP on the Research Desk - [Evidence Map: DSIP (Small human studies)](https://www.primaralabs.com/research/evidence#dsip) - [Regulatory status: DSIP](https://www.primaralabs.com/research/status#dsip) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/glow-blend-70mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/glow-blend-70mg.md # GLOW Blend 70mg, stocked in the Philippines GHK-Cu 50mg, BPC-157 10mg and TB-500 10mg in a single vial. Studied for overlapping tissue repair pathways. 10% off every order, applied in chat. Presentation Lyophilized powder, GHK-Cu 50 mg + BPC-157 10 mg + TB-500 10 mg / vial Catalogue code PRM-016 ## Buy by the pack Swipe, up to 50% off Single vial ₱3,490₱3,875 per vial Single vial, ₱3,490 total 1 vial, 70mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 25% off list ₱2,906 per vial 5 vials, ₱14,530 total 5 vials, 350mg total 5 x 3ml water · 50 syringes · 50 pads Free courier at this total, anywhere in the Philippines. Best value 10 pack · 50% off list ₱1,938 per vial 10 vials, ₱19,380 total 10 vials, 700mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. BPC-157. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. TB-500. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. GHK-Cu. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order GLOW Blend on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20GLOW%20Blend%2070mg%20(%E2%82%B13%2C490).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/glow-blend). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence BPC-157[Small human studies](https://www.primaralabs.com/research/evidence#bpc-157)TB-500[Animal and cell](https://www.primaralabs.com/research/evidence#tb-500)GHK-Cu[Small human studies](https://www.primaralabs.com/research/evidence#ghk-cu) FDA Philippines BPC-157: [Not published](https://www.primaralabs.com/research/status#bpc-157)TB-500: [Not published](https://www.primaralabs.com/research/status#tb-500)GHK-Cu: [Not published](https://www.primaralabs.com/research/status#ghk-cu) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Overview ## GLOW Blend in the Philippines GLOW Blend combines three repair-pathway peptides in one vial: GHK-Cu at 50mg, BPC-157 at 10mg and TB-500 at 10mg, for 70mg total. Each component is stocked individually in this catalogue, so the blend is a repackaging rather than a distinct compound. The three are grouped because their published research overlaps rather than because any combined effect has been characterised. GHK-Cu is studied for dermal collagen and copper-dependent signalling, BPC-157 for soft tissue and gastrointestinal repair, and TB-500 for cell migration through actin regulation. No published work studies the three together in this ratio. Primara Labs stocks GLOW Blend at ₱3,875, or ₱3,490 with the standing 10% off. Buying the three components separately from this catalogue costs more, which is the practical reason the blend exists. Supplied strictly for laboratory research use. It is not for human consumption, and Primara Labs does not provide medical advice or dosing guidance for people. ### Research focus - Composition: GHK-Cu 50mg, BPC-157 10mg, TB-500 10mg in a single lyophilized vial. - GHK-Cu: copper-binding tripeptide studied for dermal collagen and wound repair signalling. - BPC-157: pentadecapeptide studied for soft tissue and gastrointestinal repair. - TB-500: thymosin beta-4 fragment studied for cell migration and actin regulation. - The combination itself is not the subject of published research. Each component is studied separately. The GLOW Blend itself has not been studied. The findings below are for each component on its own. ## Benefits studied: BPC-157 1. #### Interstitial cystitis symptoms Small human studies In an uncontrolled pilot of 12 women with interstitial cystitis, 10 reported complete symptom resolution; there was no placebo or comparison group. [PubMed 39325560](https://pubmed.ncbi.nlm.nih.gov/39325560/) · checked 23 September 2026 2. #### Knee pain Small human studies In a retrospective phone survey of 16 clinic patients, 14 reported knee pain relief; there was no control group and no validated outcome measure. [PubMed 34324435](https://pubmed.ncbi.nlm.nih.gov/34324435/) · checked 23 September 2026 3. #### Tendon repair Animal and cell In rats with a cut Achilles tendon, BPC-157 improved mechanical, functional and microscopic healing measures compared with saline. [J Orthop Res 2003](https://doi.org/10.1016/s0736-0266(03)00110-4) · checked 23 September 2026 4. #### Ligament repair Animal and cell In rats with a surgically cut knee ligament, BPC-157 improved functional, mechanical and tissue measures of healing over 90 days. [J Orthop Res 2010](https://doi.org/10.1002/jor.21107) · checked 23 September 2026 ## Side effects reported: BPC-157 The two small uncontrolled pilots, of 2 and 12 people, reported no adverse events. A 2025 systematic review states that no clinical safety data were found. [HSS J 2025 (systematic review)](https://doi.org/10.1177/15563316251355551) · checked 23 September 2026 No human adverse event data published. [Europe PMC and ClinicalTrials.gov search, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22BPC-157%22%20OR%20TITLE_ABS%3A%22BPC%20157%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 ## Benefits studied: TB-500 1. #### Skin wound repair Animal and cell In aged and diabetic mice, the seven-amino-acid thymosin beta-4 fragment LKKTETQ promoted skin wound repair about as well as the full-length protein. [Wound Repair Regen 2003](https://doi.org/10.1046/j.1524-475x.2003.11105.x) · checked 23 September 2026 2. #### Cell wound closure Animal and cell In a cell scratch-wound test, the TB-500 breakdown product Ac-LKKTE showed wound-healing activity, while TB-500 itself did not. [J Chromatogr B 2024](https://doi.org/10.1016/j.jchromb.2024.124033) · checked 23 September 2026 ## Side effects reported: TB-500 No human adverse event data exist for TB-500. In the phase 3 trial of full-length thymosin beta-4 eye drops (ARISE-3), a different molecule, instillation site pain occurred in 6.6% against 4.6% on placebo. [ClinicalTrials.gov NCT03937882 results](https://clinicaltrials.gov/study/NCT03937882) · checked 23 September 2026 No human adverse event data published. [Europe PMC and ClinicalTrials.gov search, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22TB-500%22%20OR%20TITLE_ABS%3A%22TB500%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 ## Benefits studied: GHK-Cu 1. #### Diabetic foot ulcer closure Small human studies In a randomised, evaluator-blinded, placebo-controlled trial of a GHK-Cu gel on diabetic foot ulcers, median ulcer closure was 98.5% with the gel against 60.8% with the inactive gel; the abstract does not state the trial's size or phase. [Wound Repair Regen 1994](https://doi.org/10.1046/j.1524-475x.1994.20406.x) · checked 23 September 2026 2. #### Skin after laser resurfacing (no measured benefit) Small human studies In 13 randomised patients after laser skin resurfacing, GHK-Cu skin care made no measurable difference to redness, wrinkles or blinded ratings, though patients rated their skin quality higher. [Arch Facial Plast Surg 2006](https://doi.org/10.1001/archfaci.8.4.252) · checked 23 September 2026 3. #### Ligament graft healing Animal and cell In rats after knee ligament reconstruction, GHK-Cu reduced knee laxity at 6 weeks, but the difference had gone by 12 weeks. [J Orthop Res 2015](https://doi.org/10.1002/jor.22831) · checked 23 September 2026 4. #### Fibroblast growth Animal and cell In cell culture, GHK-Cu shortened the doubling time of normal and irradiated human skin fibroblasts and raised their early output of growth factors. [Arch Facial Plast Surg 2005](https://doi.org/10.1001/archfaci.7.1.27) · checked 23 September 2026 ## Side effects reported: GHK-Cu No human adverse event data published. [Europe PMC and ClinicalTrials.gov search, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22GHK-Cu%22%20OR%20TITLE_ABS%3A%22copper%20tripeptide%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works ### BPC-157 BPC-157 is a synthetic 15-amino-acid peptide. A 2025 systematic review summarises animal and cell studies as showing raised growth hormone receptor expression, activation of pathways for cell growth and new blood vessel formation, and lower inflammatory signalling. No receptor has been identified, and the same review notes it is broken down quickly in the liver. None of these mechanisms has been shown in people. Targets: No defined receptor; pathways proposed from animal and cell work [Source](https://doi.org/10.1177/15563316251355551) · checked 23 September 2026 ### TB-500 Thymosin beta-4 is a 43-amino-acid protein and the main actin-sequestering molecule in cells. Its central actin-binding sequence, LKKTETQ, is reported to promote cell migration, new blood vessel growth and wound healing, and TB-500 is described in the analytical literature as the acetylated form of that fragment. A 2024 cell study found the wound-healing activity came from a TB-500 breakdown product rather than TB-500 itself. Targets: Actin binding (the LKKTETQ sequence of thymosin beta-4) [Source](https://doi.org/10.1096/fj.09-142307) · checked 23 September 2026 ### GHK-Cu GHK is a tripeptide (glycine, histidine, lysine) found in human plasma, saliva and urine, and it binds copper. In laboratory work it stimulates both the production and the breakdown of collagen and related skin matrix molecules, and adjusts the enzymes that remodel tissue. The evidence for these actions comes from cell and animal studies. Targets: Copper binding; tissue remodelling enzymes (from cell and animal work) [Source](https://doi.org/10.1155/2015/648108) · checked 23 September 2026 Research ## What the research shows ### BPC-157 BPC-157 has no completed human randomised controlled trial. Its human data are three small uncontrolled reports of 2 to 16 people, and a 2025 systematic review found no clinical safety data. Almost all of its literature is rat work on tendon, ligament and gut healing. Animal and cell Animal and cell studies only. BPC-157 has been studied mostly in rats, in models of tendon, ligament, muscle and gut injury. - In rats with a cut Achilles tendon, BPC-157 improved load to failure, function and tissue appearance compared with saline. [J Orthop Res 2003](https://doi.org/10.1016/s0736-0266(03)00110-4) · checked 23 September 2026 - In rats with a surgically cut knee ligament, BPC-157 improved functional, mechanical and tissue measures of healing over 90 days. [J Orthop Res 2010](https://doi.org/10.1002/jor.21107) · checked 23 September 2026 - In rats with restricted then restored blood flow to the hind limb, BPC-157 lowered markers of oxidative stress and cell death. [Sci Rep 2026](https://doi.org/10.1038/s41598-026-55449-1) · checked 23 September 2026 ### TB-500 No human trial of TB-500, the acetylated thymosin beta-4 fragment Ac-LKKTETQ, has reported; its evidence is animal and cell work. Full-length thymosin beta-4 has been studied in people, mostly as eye drops, where two phase 3 dry-eye trials posted near-identical results in both arms. A 2024 cell study found the wound-healing activity came from a TB-500 breakdown product rather than TB-500 itself. Animal and cell Animal and cell studies only for TB-500. Human trials exist for full-length thymosin beta-4, a different molecule, mostly as eye drops; see the Evidence Map. - In aged and diabetic mice, the seven-amino-acid fragment LKKTETQ promoted skin wound repair about as well as full-length thymosin beta-4. [Wound Repair Regen 2003](https://doi.org/10.1046/j.1524-475x.2003.11105.x) · checked 23 September 2026 - In a cell scratch-wound test, only the TB-500 breakdown product Ac-LKKTE showed wound-healing activity, not TB-500 itself. [J Chromatogr B 2024](https://doi.org/10.1016/j.jchromb.2024.124033) · checked 23 September 2026 - A rat Achilles tendon repair study described its molecule as synthetic thymosin beta-4 (TB-500) without stating the sequence in the abstract. [Jt Dis Relat Surg 2026](https://doi.org/10.52312/jdrs.2026.2951) · checked 23 September 2026 ### GHK-Cu GHK-Cu is a copper-binding tripeptide found in human plasma. Its human evidence is two small topical trials, one in diabetic foot ulcers from 1994 and one after laser skin resurfacing that found no objective benefit; a 2025 review notes a surprising absence of clinical studies. Most of its literature is cell and animal work. Animal and cell Mostly cell and animal work. The two human trials found are small and topical. - In rats after knee ligament reconstruction, GHK-Cu reduced knee laxity at 6 weeks; the difference had gone by 12 weeks. [J Orthop Res 2015](https://doi.org/10.1002/jor.22831) · checked 23 September 2026 - In an irradiated rat wound model, topical GHK-Cu showed no benefit. [Otolaryngol Head Neck Surg 2013](https://doi.org/10.1177/0194599813492644) · checked 23 September 2026 - In cell culture, GHK-Cu shortened the doubling time of normal and irradiated human skin fibroblasts. [Arch Facial Plast Surg 2005](https://doi.org/10.1001/archfaci.7.1.27) · checked 23 September 2026 Specification ## Compound specification ### BPC-157 | Compound class | Synthetic pentadecapeptide | | Targets or pathway | No defined receptor; pathways proposed from animal and cell work | | Sequence | GEPPPGKPADDAGLV[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | Molecular formula | C62H98N16O22[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | Molecular weight | 1419.5 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | CAS number | 137525-51-0[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | PubChem CID | [9941957](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) | ### TB-500 | Compound class | Thymosin beta-4 related peptide | | Targets or pathway | Actin binding (the LKKTETQ sequence of thymosin beta-4) | | Sequence | Confirming with supplier | | Molecular formula | Confirming with supplier | | Molecular weight | Confirming with supplier | | CAS number | Confirming with supplier | | PubChem CID | Not published | The catalogue listed the full 43-residue thymosin beta-4 sequence under the name TB-500, while the analytical literature identifies TB-500 as the fragment Ac-LKKTETQ, and the catalogue's formula matched neither PubChem record. Identity fields are withheld until the supplier confirms which molecule the vial contains. ### GHK-Cu | Compound class | Copper-binding tripeptide | | Targets or pathway | Copper binding; tissue remodelling enzymes (from cell and animal work) | | Sequence | Gly-His-Lys, as a copper complex[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/73587) · checked 23 September 2026 | | Molecular formula | Not published | | Molecular weight | Not published | | CAS number | Not published | | PubChem CID | Not published | PubChem records the GHK-copper complex under several formulas, so formula, weight and CAS are not published for the complex. The free tripeptide GHK is PubChem CID 73587. | Form | Lyophilised powder | | Vial | Lyophilized powder, GHK-Cu 50 mg + BPC-157 10 mg + TB-500 10 mg / vial | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 2.0 ml | 35 mg/ml total | Highest concentration, smallest volumes | | 5.0 ml | 14 mg/ml total | Common reference dilution | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-30ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for GLOW Blend 70mg](https://www.primaralabs.com/calculator?c=glow-blend-70mg) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## GLOW Blend batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status ### BPC-157 FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22BPC-157%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [BPC-157 on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#bpc-157) ### TB-500 FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22thymosin%20beta-4%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [TB-500 on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#tb-500) ### GHK-Cu FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22GHK-Cu%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [GHK-Cu on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#ghk-cu) Frequently asked ## GLOW Blend questions, answered ### How much does GLOW Blend cost at Primara Labs? GLOW Blend 70mg vials are ₱3,875, or ₱3,490 with the standing 10% off. ### What is in GLOW Blend? Each vial contains GHK-Cu 50mg, BPC-157 10mg and TB-500 10mg, for 70mg total. ### Is the combination itself studied? No. Each of the three components has its own published research, but no work studies them together in this ratio. The blend is a repackaging of three separately stocked compounds. ### What is BPC-157 studied for? BPC-157 has no completed human randomised controlled trial. Its human data are three small uncontrolled reports of 2 to 16 people, and a 2025 systematic review found no clinical safety data. Almost all of its literature is rat work on tendon, ligament and gut healing. ### What is TB-500 studied for? No human trial of TB-500, the acetylated thymosin beta-4 fragment Ac-LKKTETQ, has reported; its evidence is animal and cell work. Full-length thymosin beta-4 has been studied in people, mostly as eye drops, where two phase 3 dry-eye trials posted near-identical results in both arms. A 2024 cell study found the wound-healing activity came from a TB-500 breakdown product rather than TB-500 itself. ### What is GHK-Cu studied for? GHK-Cu is a copper-binding tripeptide found in human plasma. Its human evidence is two small topical trials, one in diabetic foot ulcers from 1994 and one after laser skin resurfacing that found no objective benefit; a 2025 review notes a surprising absence of clinical studies. Most of its literature is cell and animal work. ### What side effects were reported for the GLOW Blend components? BPC-157: The two small uncontrolled pilots, of 2 and 12 people, reported no adverse events. A 2025 systematic review states that no clinical safety data were found. TB-500: No human adverse event data exist for TB-500. In the phase 3 trial of full-length thymosin beta-4 eye drops (ARISE-3), a different molecule, instillation site pain occurred in 6.6% against 4.6% on placebo. GHK-Cu: No human adverse event data published (Europe PMC and ClinicalTrials.gov search, 23 September 2026). ### Is GLOW Blend approved in the Philippines? BPC-157. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. TB-500. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. GHK-Cu. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. ### How should GLOW Blend be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for GLOW Blend? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-017 KLOW Blend 80mg ₱3,990](https://www.primaralabs.com/marketplace/klow-blend-80mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about GLOW Blend, answered - [What does GHK-Cu do in research?](https://www.primaralabs.com/answers/what-does-ghk-cu-do-in-research) - [Is BPC-157 FDA approved?](https://www.primaralabs.com/answers/is-bpc-157-fda-approved) - [Is TB-500 FDA approved?](https://www.primaralabs.com/answers/is-tb-500-fda-approved) - [Is GHK-Cu FDA approved?](https://www.primaralabs.com/answers/is-ghk-cu-fda-approved) - [Is there human research on BPC-157?](https://www.primaralabs.com/answers/is-there-human-research-on-bpc-157) Research Desk ## GLOW Blend on the Research Desk - [Evidence Map: BPC-157 (Small human studies)](https://www.primaralabs.com/research/evidence#bpc-157) - [Evidence Map: TB-500 (Animal and cell)](https://www.primaralabs.com/research/evidence#tb-500) - [Evidence Map: GHK-Cu (Small human studies)](https://www.primaralabs.com/research/evidence#ghk-cu) - [Regulatory status: BPC-157](https://www.primaralabs.com/research/status#bpc-157) - [Regulatory status: TB-500](https://www.primaralabs.com/research/status#tb-500) - [Regulatory status: GHK-Cu](https://www.primaralabs.com/research/status#ghk-cu) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/marketplace/klow-blend-80mg Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/marketplace/klow-blend-80mg.md # KLOW Blend 80mg, Philippines KPV 10mg added to the GLOW combination. Studied for repair signalling alongside inflammatory pathways. 10% off every order, applied in chat. Presentation Lyophilized powder, KPV 10 mg + GHK-Cu 50 mg + BPC-157 10 mg + TB-500 10 mg / vial Catalogue code PRM-017 ## Buy by the pack Swipe, up to 50% off Single vial ₱3,990₱4,430 per vial Single vial, ₱3,990 total 1 vial, 80mg total 3ml water · 10 syringes · 10 pads Courier is a flat rate per region, on the delivery page. Featured 5 pack · 25% off list ₱3,323 per vial 5 vials, ₱16,615 total 5 vials, 400mg total 5 x 3ml water · 50 syringes · 50 pads Free courier at this total, anywhere in the Philippines. Best value 10 pack · 50% off list ₱2,215 per vial 10 vials, ₱22,150 total 10 vials, 800mg total 10 x 3ml water · 100 syringes · 100 pads Free courier at this total, anywhere in the Philippines. Every order ships with bacteriostatic water, insulin syringes, alcohol pads and a reconstitution syringe, included rather than sold separately. [See what ships in the box](https://www.primaralabs.com/wholesale/kits). Packs are a single compound. No mixing across compounds. Packs are the same compound and the tier price is cut from the list price, not stacked on the standing discount. Here is [how the pack tiers work](https://www.primaralabs.com/bulk) across the whole catalogue. BPC-157. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. TB-500. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. GHK-Cu. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. KPV. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. Updated 23 September 2026 [60-day money-back guarantee](https://www.primaralabs.com/guarantee) Independently verifiable. If an accredited lab disagrees with the label, we refund it. [Terms](https://www.primaralabs.com/guarantee) If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. [Same-day delivery](https://www.primaralabs.com/delivery): Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. - [Metro Manila](https://www.primaralabs.com/buy-peptides#ncr) Same day Grab Express / Lalamove, ₱150, 14 areas - [Luzon](https://www.primaralabs.com/buy-peptides#luzon) 1 to 2 business days J&T Express, ₱250, 18 areas - [Visayas](https://www.primaralabs.com/buy-peptides#visayas) 2 to 3 business days J&T Express, ₱250, 7 areas - [Mindanao](https://www.primaralabs.com/buy-peptides#mindanao) 3 to 5 business days J&T Express, ₱300, 6 areas [Order KLOW Blend on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'd%20like%20to%20order%20KLOW%20Blend%2080mg%20(%E2%82%B13%2C990).%20Please%20send%20payment%20and%20delivery%20details.%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A)[Full catalogue](https://www.primaralabs.com/marketplace) Pay by GCash, Maya or QR Ph here, or Wise, Zelle, US bank transfer or crypto from abroad, confirmed in chat. [Paying from abroad while in Manila](https://www.primaralabs.com/international). [Price per vial and per mg](https://www.primaralabs.com/prices/klow-blend). Cold-chain packed Insulated packaging from storage to your door Same-day Metro Manila Confirmed before 12 noon, delivered the same day Stocked locally No customs leg, no international wait The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. [Batch reports for every compound](https://www.primaralabs.com/coa) Human evidence BPC-157[Small human studies](https://www.primaralabs.com/research/evidence#bpc-157)TB-500[Animal and cell](https://www.primaralabs.com/research/evidence#tb-500)GHK-Cu[Small human studies](https://www.primaralabs.com/research/evidence#ghk-cu)KPV[Animal and cell](https://www.primaralabs.com/research/evidence#kpv) FDA Philippines BPC-157: [Not published](https://www.primaralabs.com/research/status#bpc-157)TB-500: [Not published](https://www.primaralabs.com/research/status#tb-500)GHK-Cu: [Not published](https://www.primaralabs.com/research/status#ghk-cu)KPV: [Not published](https://www.primaralabs.com/research/status#kpv) Latest batch report Report pending Storage 2 to 8 °C sealed (Primara instruction) Sister site ## Not sure where to start? Longevity Manila asks what you are working on and puts a research protocol together around the answer, then sends the list back here to order. [Plan a protocol around your goal](https://www.longevitymanila.com/recovery?ref=pl) Overview ## KLOW Blend in the Philippines KLOW Blend is the GLOW combination with KPV added: KPV at 10mg, GHK-Cu at 50mg, BPC-157 at 10mg and TB-500 at 10mg, for 80mg total across four peptides. KPV is the tripeptide tail of alpha-MSH and is the component that separates this blend from GLOW. Its published research sits on inflammatory signalling rather than on structural repair, which is why the two blends are studied under different headings even though three of the four components are shared. Primara Labs stocks KLOW Blend at ₱4,430, or ₱3,990 with the standing 10% off. As with GLOW, every component is stocked individually in this catalogue and no published work studies the four together in this ratio. Supplied strictly for laboratory research use. It is not for human consumption, and Primara Labs does not provide medical advice or dosing guidance for people. KLOW is the 80mg blend: the three GLOW peptides with KPV added, freeze-dried together in one vial. Store it in the fridge, sealed and away from light, and keep it cold after mixing. The order is placed in WhatsApp from the button above, and the reply covers availability, the peso total and same-day Metro Manila delivery on orders confirmed before 12 noon. KPV is the part that sets KLOW apart; read the [KPV guide](https://www.philippinespeptides.com/peptides/kpv) for the research on it. ### Research focus - Composition: KPV 10mg, GHK-Cu 50mg, BPC-157 10mg, TB-500 10mg in a single lyophilized vial. - KPV: the tripeptide tail of alpha-MSH, studied for inflammatory pathway signalling. - The remaining three components match GLOW Blend and are studied for repair pathways. - The combination itself is not the subject of published research. Each component is studied separately. The KLOW Blend itself has not been studied. The findings below are for each component on its own. ## Benefits studied: BPC-157 1. #### Interstitial cystitis symptoms Small human studies In an uncontrolled pilot of 12 women with interstitial cystitis, 10 reported complete symptom resolution; there was no placebo or comparison group. [PubMed 39325560](https://pubmed.ncbi.nlm.nih.gov/39325560/) · checked 23 September 2026 2. #### Knee pain Small human studies In a retrospective phone survey of 16 clinic patients, 14 reported knee pain relief; there was no control group and no validated outcome measure. [PubMed 34324435](https://pubmed.ncbi.nlm.nih.gov/34324435/) · checked 23 September 2026 3. #### Tendon repair Animal and cell In rats with a cut Achilles tendon, BPC-157 improved mechanical, functional and microscopic healing measures compared with saline. [J Orthop Res 2003](https://doi.org/10.1016/s0736-0266(03)00110-4) · checked 23 September 2026 4. #### Ligament repair Animal and cell In rats with a surgically cut knee ligament, BPC-157 improved functional, mechanical and tissue measures of healing over 90 days. [J Orthop Res 2010](https://doi.org/10.1002/jor.21107) · checked 23 September 2026 ## Side effects reported: BPC-157 The two small uncontrolled pilots, of 2 and 12 people, reported no adverse events. A 2025 systematic review states that no clinical safety data were found. [HSS J 2025 (systematic review)](https://doi.org/10.1177/15563316251355551) · checked 23 September 2026 No human adverse event data published. [Europe PMC and ClinicalTrials.gov search, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22BPC-157%22%20OR%20TITLE_ABS%3A%22BPC%20157%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 ## Benefits studied: TB-500 1. #### Skin wound repair Animal and cell In aged and diabetic mice, the seven-amino-acid thymosin beta-4 fragment LKKTETQ promoted skin wound repair about as well as the full-length protein. [Wound Repair Regen 2003](https://doi.org/10.1046/j.1524-475x.2003.11105.x) · checked 23 September 2026 2. #### Cell wound closure Animal and cell In a cell scratch-wound test, the TB-500 breakdown product Ac-LKKTE showed wound-healing activity, while TB-500 itself did not. [J Chromatogr B 2024](https://doi.org/10.1016/j.jchromb.2024.124033) · checked 23 September 2026 ## Side effects reported: TB-500 No human adverse event data exist for TB-500. In the phase 3 trial of full-length thymosin beta-4 eye drops (ARISE-3), a different molecule, instillation site pain occurred in 6.6% against 4.6% on placebo. [ClinicalTrials.gov NCT03937882 results](https://clinicaltrials.gov/study/NCT03937882) · checked 23 September 2026 No human adverse event data published. [Europe PMC and ClinicalTrials.gov search, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22TB-500%22%20OR%20TITLE_ABS%3A%22TB500%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 ## Benefits studied: GHK-Cu 1. #### Diabetic foot ulcer closure Small human studies In a randomised, evaluator-blinded, placebo-controlled trial of a GHK-Cu gel on diabetic foot ulcers, median ulcer closure was 98.5% with the gel against 60.8% with the inactive gel; the abstract does not state the trial's size or phase. [Wound Repair Regen 1994](https://doi.org/10.1046/j.1524-475x.1994.20406.x) · checked 23 September 2026 2. #### Skin after laser resurfacing (no measured benefit) Small human studies In 13 randomised patients after laser skin resurfacing, GHK-Cu skin care made no measurable difference to redness, wrinkles or blinded ratings, though patients rated their skin quality higher. [Arch Facial Plast Surg 2006](https://doi.org/10.1001/archfaci.8.4.252) · checked 23 September 2026 3. #### Ligament graft healing Animal and cell In rats after knee ligament reconstruction, GHK-Cu reduced knee laxity at 6 weeks, but the difference had gone by 12 weeks. [J Orthop Res 2015](https://doi.org/10.1002/jor.22831) · checked 23 September 2026 4. #### Fibroblast growth Animal and cell In cell culture, GHK-Cu shortened the doubling time of normal and irradiated human skin fibroblasts and raised their early output of growth factors. [Arch Facial Plast Surg 2005](https://doi.org/10.1001/archfaci.7.1.27) · checked 23 September 2026 ## Side effects reported: GHK-Cu No human adverse event data published. [Europe PMC and ClinicalTrials.gov search, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22GHK-Cu%22%20OR%20TITLE_ABS%3A%22copper%20tripeptide%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 ## Benefits studied: KPV 1. #### Colitis Animal and cell In mice with chemically induced colitis, KPV reduced colitis and inflammatory cytokine expression. [Gastroenterology 2008](https://doi.org/10.1053/j.gastro.2007.10.026) · checked 23 September 2026 2. #### Recovery from colitis Animal and cell In two mouse colitis models, KPV-treated mice recovered earlier and regained more body weight, with less inflammatory infiltrate. [Inflamm Bowel Dis 2008](https://doi.org/10.1002/ibd.20334) · checked 23 September 2026 3. #### Colitis-associated tumours Animal and cell In mice with colitis-associated cancer, KPV prevented tumour formation; it had no effect in mice lacking the PepT1 transporter. [Cell Mol Gastroenterol Hepatol 2016](https://doi.org/10.1016/j.jcmgh.2016.01.006) · checked 23 September 2026 4. #### Oral mucositis Animal and cell In rats with chemotherapy-induced mouth ulcers, KPV in an adhesive gel improved food intake and body-weight recovery. [Biomater Sci 2022](https://doi.org/10.1039/d1bm01466h) · checked 23 September 2026 ## Side effects reported: KPV No human adverse event data published. [Europe PMC and ClinicalTrials.gov search, 23 September 2026](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22KPV%22%20OR%20TITLE_ABS%3A%22Lys-Pro-Val%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only. Mechanism ## How it works ### BPC-157 BPC-157 is a synthetic 15-amino-acid peptide. A 2025 systematic review summarises animal and cell studies as showing raised growth hormone receptor expression, activation of pathways for cell growth and new blood vessel formation, and lower inflammatory signalling. No receptor has been identified, and the same review notes it is broken down quickly in the liver. None of these mechanisms has been shown in people. Targets: No defined receptor; pathways proposed from animal and cell work [Source](https://doi.org/10.1177/15563316251355551) · checked 23 September 2026 ### TB-500 Thymosin beta-4 is a 43-amino-acid protein and the main actin-sequestering molecule in cells. Its central actin-binding sequence, LKKTETQ, is reported to promote cell migration, new blood vessel growth and wound healing, and TB-500 is described in the analytical literature as the acetylated form of that fragment. A 2024 cell study found the wound-healing activity came from a TB-500 breakdown product rather than TB-500 itself. Targets: Actin binding (the LKKTETQ sequence of thymosin beta-4) [Source](https://doi.org/10.1096/fj.09-142307) · checked 23 September 2026 ### GHK-Cu GHK is a tripeptide (glycine, histidine, lysine) found in human plasma, saliva and urine, and it binds copper. In laboratory work it stimulates both the production and the breakdown of collagen and related skin matrix molecules, and adjusts the enzymes that remodel tissue. The evidence for these actions comes from cell and animal studies. Targets: Copper binding; tissue remodelling enzymes (from cell and animal work) [Source](https://doi.org/10.1155/2015/648108) · checked 23 September 2026 ### KPV KPV is the last three amino acids of alpha-melanocyte-stimulating hormone. In cell studies it enters intestinal and immune cells through the peptide transporter PepT1 and dampens NF-kB and MAP kinase inflammatory signalling. A mouse study found its anti-inflammatory effect is unlikely to act through melanocortin receptors. Targets: PepT1 transporter uptake; NF-kB and MAP kinase inflammatory signalling (cell work) [Source](https://doi.org/10.1053/j.gastro.2007.10.026) · checked 23 September 2026 Research ## What the research shows ### BPC-157 BPC-157 has no completed human randomised controlled trial. Its human data are three small uncontrolled reports of 2 to 16 people, and a 2025 systematic review found no clinical safety data. Almost all of its literature is rat work on tendon, ligament and gut healing. Animal and cell Animal and cell studies only. BPC-157 has been studied mostly in rats, in models of tendon, ligament, muscle and gut injury. - In rats with a cut Achilles tendon, BPC-157 improved load to failure, function and tissue appearance compared with saline. [J Orthop Res 2003](https://doi.org/10.1016/s0736-0266(03)00110-4) · checked 23 September 2026 - In rats with a surgically cut knee ligament, BPC-157 improved functional, mechanical and tissue measures of healing over 90 days. [J Orthop Res 2010](https://doi.org/10.1002/jor.21107) · checked 23 September 2026 - In rats with restricted then restored blood flow to the hind limb, BPC-157 lowered markers of oxidative stress and cell death. [Sci Rep 2026](https://doi.org/10.1038/s41598-026-55449-1) · checked 23 September 2026 ### TB-500 No human trial of TB-500, the acetylated thymosin beta-4 fragment Ac-LKKTETQ, has reported; its evidence is animal and cell work. Full-length thymosin beta-4 has been studied in people, mostly as eye drops, where two phase 3 dry-eye trials posted near-identical results in both arms. A 2024 cell study found the wound-healing activity came from a TB-500 breakdown product rather than TB-500 itself. Animal and cell Animal and cell studies only for TB-500. Human trials exist for full-length thymosin beta-4, a different molecule, mostly as eye drops; see the Evidence Map. - In aged and diabetic mice, the seven-amino-acid fragment LKKTETQ promoted skin wound repair about as well as full-length thymosin beta-4. [Wound Repair Regen 2003](https://doi.org/10.1046/j.1524-475x.2003.11105.x) · checked 23 September 2026 - In a cell scratch-wound test, only the TB-500 breakdown product Ac-LKKTE showed wound-healing activity, not TB-500 itself. [J Chromatogr B 2024](https://doi.org/10.1016/j.jchromb.2024.124033) · checked 23 September 2026 - A rat Achilles tendon repair study described its molecule as synthetic thymosin beta-4 (TB-500) without stating the sequence in the abstract. [Jt Dis Relat Surg 2026](https://doi.org/10.52312/jdrs.2026.2951) · checked 23 September 2026 ### GHK-Cu GHK-Cu is a copper-binding tripeptide found in human plasma. Its human evidence is two small topical trials, one in diabetic foot ulcers from 1994 and one after laser skin resurfacing that found no objective benefit; a 2025 review notes a surprising absence of clinical studies. Most of its literature is cell and animal work. Animal and cell Mostly cell and animal work. The two human trials found are small and topical. - In rats after knee ligament reconstruction, GHK-Cu reduced knee laxity at 6 weeks; the difference had gone by 12 weeks. [J Orthop Res 2015](https://doi.org/10.1002/jor.22831) · checked 23 September 2026 - In an irradiated rat wound model, topical GHK-Cu showed no benefit. [Otolaryngol Head Neck Surg 2013](https://doi.org/10.1177/0194599813492644) · checked 23 September 2026 - In cell culture, GHK-Cu shortened the doubling time of normal and irradiated human skin fibroblasts. [Arch Facial Plast Surg 2005](https://doi.org/10.1001/archfaci.7.1.27) · checked 23 September 2026 ### KPV KPV is the three-amino-acid tail (Lys-Pro-Val) of alpha-melanocyte-stimulating hormone. It has never been given to people in a published study; its evidence is mouse, rat and cell work, mostly in colitis models. Animal and cell Animal and cell studies only; KPV has not been given to people in a published study. - In mice with chemically induced colitis, KPV reduced colitis and inflammatory cytokine expression. [Gastroenterology 2008](https://doi.org/10.1053/j.gastro.2007.10.026) · checked 23 September 2026 - In two mouse colitis models, KPV-treated mice recovered earlier with less inflammatory infiltrate. [Inflamm Bowel Dis 2008](https://doi.org/10.1002/ibd.20334) · checked 23 September 2026 - In mice with induced peritonitis, KPV reduced the inflammatory response. [J Pharmacol Exp Ther 2003](https://doi.org/10.1124/jpet.103.051623) · checked 23 September 2026 Specification ## Compound specification ### BPC-157 | Compound class | Synthetic pentadecapeptide | | Targets or pathway | No defined receptor; pathways proposed from animal and cell work | | Sequence | GEPPPGKPADDAGLV[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | Molecular formula | C62H98N16O22[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | Molecular weight | 1419.5 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | CAS number | 137525-51-0[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) · checked 23 September 2026 | | PubChem CID | [9941957](https://pubchem.ncbi.nlm.nih.gov/compound/9941957) | ### TB-500 | Compound class | Thymosin beta-4 related peptide | | Targets or pathway | Actin binding (the LKKTETQ sequence of thymosin beta-4) | | Sequence | Confirming with supplier | | Molecular formula | Confirming with supplier | | Molecular weight | Confirming with supplier | | CAS number | Confirming with supplier | | PubChem CID | Not published | The catalogue listed the full 43-residue thymosin beta-4 sequence under the name TB-500, while the analytical literature identifies TB-500 as the fragment Ac-LKKTETQ, and the catalogue's formula matched neither PubChem record. Identity fields are withheld until the supplier confirms which molecule the vial contains. ### GHK-Cu | Compound class | Copper-binding tripeptide | | Targets or pathway | Copper binding; tissue remodelling enzymes (from cell and animal work) | | Sequence | Gly-His-Lys, as a copper complex[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/73587) · checked 23 September 2026 | | Molecular formula | Not published | | Molecular weight | Not published | | CAS number | Not published | | PubChem CID | Not published | PubChem records the GHK-copper complex under several formulas, so formula, weight and CAS are not published for the complex. The free tripeptide GHK is PubChem CID 73587. ### KPV | Compound class | Tripeptide (alpha-MSH 11-13) | | Targets or pathway | PepT1 transporter uptake; NF-kB and MAP kinase inflammatory signalling (cell work) | | Sequence | Lys-Pro-Val[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/125672) · checked 23 September 2026 | | Molecular formula | C16H30N4O4[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/125672) · checked 23 September 2026 | | Molecular weight | 342.43 g/mol[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/125672) · checked 23 September 2026 | | CAS number | 67727-97-3[PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/125672) · checked 23 September 2026 | | PubChem CID | [125672](https://pubchem.ncbi.nlm.nih.gov/compound/125672) | | Form | Lyophilised powder | | Vial | Lyophilized powder, KPV 10 mg + GHK-Cu 50 mg + BPC-157 10 mg + TB-500 10 mg / vial | Laboratory handling ## Reconstitution reference | BAC water added | Resulting concentration | Note | | --- | --- | --- | | 2.0 ml | 40 mg/ml total | Highest concentration, smallest volumes | | 5.0 ml | 16 mg/ml total | Common reference dilution | Reconstitute with [bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml). Reference values are for laboratory preparation only. Other volumes and syringe scales: [reconstitution calculator, prefilled for KLOW Blend 80mg](https://www.primaralabs.com/calculator?c=klow-blend-80mg) ### Handling and storage Sealed vials Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. Primara Labs storage instruction Adding diluent Add the diluent slowly down the inside wall of the vial rather than straight onto the powder. Mixing The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 Appearance The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it. [Tesamorelin US instructions for use, DailyMed](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=839334d3-8c1d-4c26-9036-2ab524a6ea75) · checked 23 September 2026 After the stopper is punctured CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. [CDC, Preventing Unsafe Injection Practices](https://www.cdc.gov/injection-safety/hcp/clinical-safety/index.html) · checked 23 September 2026 Laboratory ## KLOW Blend batch reports Report pending. Every report Primara publishes is on the [batch reports page](https://www.primaralabs.com/coa), or [look up the batch printed on your vial](https://www.primaralabs.com/batch). Regulatory ## Regulatory status ### BPC-157 FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22BPC-157%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [BPC-157 on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#bpc-157) ### TB-500 FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22thymosin%20beta-4%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [TB-500 on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#tb-500) ### GHK-Cu FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22GHK-Cu%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [GHK-Cu on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#ghk-cu) ### KPV FDA Philippines Not published Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22KPV%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not published No sponsor identified in any record read. Not published [KPV on the Regulatory Status Tracker](https://www.primaralabs.com/research/status#kpv) Frequently asked ## KLOW Blend questions, answered ### How much does KLOW Blend cost at Primara Labs? KLOW Blend 80mg vials are ₱4,430, or ₱3,990 with the standing 10% off. ### What is the difference between KLOW and GLOW? KLOW is the GLOW combination with KPV 10mg added, for 80mg total across four peptides instead of 70mg across three. KPV is studied for inflammatory pathway signalling rather than structural repair. ### Is the combination itself studied? No. Each of the four components has its own published research, but no work studies them together in this ratio. The blend is a repackaging of separately stocked compounds. ### What is BPC-157 studied for? BPC-157 has no completed human randomised controlled trial. Its human data are three small uncontrolled reports of 2 to 16 people, and a 2025 systematic review found no clinical safety data. Almost all of its literature is rat work on tendon, ligament and gut healing. ### What is TB-500 studied for? No human trial of TB-500, the acetylated thymosin beta-4 fragment Ac-LKKTETQ, has reported; its evidence is animal and cell work. Full-length thymosin beta-4 has been studied in people, mostly as eye drops, where two phase 3 dry-eye trials posted near-identical results in both arms. A 2024 cell study found the wound-healing activity came from a TB-500 breakdown product rather than TB-500 itself. ### What is GHK-Cu studied for? GHK-Cu is a copper-binding tripeptide found in human plasma. Its human evidence is two small topical trials, one in diabetic foot ulcers from 1994 and one after laser skin resurfacing that found no objective benefit; a 2025 review notes a surprising absence of clinical studies. Most of its literature is cell and animal work. ### What is KPV studied for? KPV is the three-amino-acid tail (Lys-Pro-Val) of alpha-melanocyte-stimulating hormone. It has never been given to people in a published study; its evidence is mouse, rat and cell work, mostly in colitis models. ### What side effects were reported for the KLOW Blend components? BPC-157: The two small uncontrolled pilots, of 2 and 12 people, reported no adverse events. A 2025 systematic review states that no clinical safety data were found. TB-500: No human adverse event data exist for TB-500. In the phase 3 trial of full-length thymosin beta-4 eye drops (ARISE-3), a different molecule, instillation site pain occurred in 6.6% against 4.6% on placebo. GHK-Cu: No human adverse event data published (Europe PMC and ClinicalTrials.gov search, 23 September 2026). KPV: No human adverse event data published (Europe PMC and ClinicalTrials.gov search, 23 September 2026). ### Is KLOW Blend approved in the Philippines? BPC-157. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. TB-500. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. GHK-Cu. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. KPV. FDA Philippines: not established. US FDA: No record found. Checked 23 September 2026. ### How should KLOW Blend be stored? Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry. ### Does Primara publish lab reports for KLOW Blend? The first published batch report is retatrutide batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued. Related compounds [PRM-016 GLOW Blend 70mg ₱3,490](https://www.primaralabs.com/marketplace/glow-blend-70mg)[PRM-004 GHK-Cu 50mg ₱1,190](https://www.primaralabs.com/marketplace/ghk-cu-50mg)[PRM-002 BPC-157 20mg ₱2,390](https://www.primaralabs.com/marketplace/bpc-157-20mg) Dispatch ## Peptide Stock Already in the Philippines Nothing on this site ships from overseas. Every vial is held in Metro Manila cold storage and moves on a local courier, which is why the window is hours instead of weeks. Metro Manila Same day Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. [Peptide delivery](https://www.primaralabs.com/delivery): windows, cutoff and coverage. Rest of the Philippines 1-5 business days Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier & packaging Discreet, insulated Plain outer packaging with no compound names. Courier is free over ₱10,000 in every region; below that it is ₱150 for a metro rider and a flat J&T Express rate per region. Beyond the catalogue ## Need peptides not listed? The catalogue is what we hold in Metro Manila cold storage right now, not the limit of what we can source. Looking for a different peptide, a different vial size, or a compound we do not list? Message us on WhatsApp and we will tell you straight away whether we can get it, at what price, and how fast. [Ask us on WhatsApp](https://wa.me/639631931789?text=Hi%20Primara%20Labs%2C%20I'm%20looking%20for%20a%20peptide%20that's%20not%20in%20the%20catalogue%3A%0A%0APayment%3A%0ADelivery%20area%3A%0ARef%3A) Answers ## Questions about KLOW Blend, answered - [Is KPV approved in the Philippines?](https://www.primaralabs.com/answers/is-kpv-approved-in-the-philippines) - [What is KPV studied for?](https://www.primaralabs.com/answers/what-is-kpv-studied-for) - [Is BPC-157 FDA approved?](https://www.primaralabs.com/answers/is-bpc-157-fda-approved) - [Is TB-500 FDA approved?](https://www.primaralabs.com/answers/is-tb-500-fda-approved) - [Is GHK-Cu FDA approved?](https://www.primaralabs.com/answers/is-ghk-cu-fda-approved) Research Desk ## KLOW Blend on the Research Desk - [Evidence Map: BPC-157 (Small human studies)](https://www.primaralabs.com/research/evidence#bpc-157) - [Evidence Map: TB-500 (Animal and cell)](https://www.primaralabs.com/research/evidence#tb-500) - [Evidence Map: GHK-Cu (Small human studies)](https://www.primaralabs.com/research/evidence#ghk-cu) - [Evidence Map: KPV (Animal and cell)](https://www.primaralabs.com/research/evidence#kpv) - [Regulatory status: BPC-157](https://www.primaralabs.com/research/status#bpc-157) - [Regulatory status: TB-500](https://www.primaralabs.com/research/status#tb-500) - [Regulatory status: GHK-Cu](https://www.primaralabs.com/research/status#ghk-cu) - [Regulatory status: KPV](https://www.primaralabs.com/research/status#kpv) All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See [Research Use Only terms](https://www.primaralabs.com/terms#ruo). --- URL: https://www.primaralabs.com/research Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research.md # Reference data on research peptides, sourced line by line. The Primara Research Desk publishes free reference datasets and tools on the compounds in the Primara Labs catalogue: what human trials found, how strong the evidence is, where each compound stands with regulators, and which batch reports exist. Every figure links to the primary source it was read from and the date it was checked. Last updated 23 September 2026. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Datasets ## Datasets - [Evidence Map: human evidence for research peptides For each research compound in the Primara Labs catalogue: the highest level of human evidence found, the completed human randomised trials identified, what it is studied for, and the key source. 16 rows · updated 23 September 2026](https://www.primaralabs.com/research/evidence) - [Benefits studied: research peptide findings by evidence level What research found for each compound, one finding per row, ordered strongest evidence first, each with its evidence level and primary source. Animal and cell findings are labelled as such. 60 rows · updated 23 September 2026](https://www.primaralabs.com/research/evidence) - [Research peptide compound profiles For each research compound in the Primara Labs catalogue: class, receptor targets or pathway, mechanism in plain language, and PubChem identity (CID, formula, weight, CAS, sequence), each field sourced and dated. 16 rows · updated 23 September 2026](https://www.primaralabs.com/research/evidence) - [Human trials of research peptides Human trials of compounds in the Primara Labs catalogue: phase, population, size, duration, primary endpoint, body-weight change by arm against comparator, discontinuation, registry ID and source. 40 rows · updated 23 September 2026](https://www.primaralabs.com/research/trials) - [Adverse events in human trials of research peptides Adverse event and discontinuation rates by arm, with the comparator's rate, for every trial in the trials dataset that reports them. 122 rows · updated 23 September 2026](https://www.primaralabs.com/research/trials) - [Regulatory status of research peptides For each research compound in the Primara Labs catalogue: status with FDA Philippines, the US FDA and the EMA, and the sponsor's stated next milestone, each sourced and dated. 16 rows · updated 23 September 2026](https://www.primaralabs.com/research/status) - [FDA Philippines advisories naming research peptides FDA Philippines advisories that name a compound in the Primara Labs catalogue, with number, date, a one-sentence factual summary and a link. Only advisories that could be opened are listed. 8 rows · updated 23 September 2026](https://www.primaralabs.com/research/status) - [Peptide laboratory tests and prices Tests a buyer can commission from independent analytical laboratories: what each covers, published US dollar price, turnaround and sample requirements, read from each laboratory's own site. 70 rows · updated 23 September 2026](https://www.primaralabs.com/tools/lab-test-planner) - [Primara Labs batch reports Every laboratory report published for a Primara Labs batch: laboratory, test, what it covers and does not, result as printed, task number and verification key. 1 rows · updated 23 September 2026](https://www.primaralabs.com/batch) Every dataset downloads as JSON and CSV from the [data index](https://www.primaralabs.com/data). Tools ## Tools - [COA Reader Open a laboratory's own record of a report from its task number and key, and check it against what a seller shows. Nothing entered is sent anywhere. Updated 23 September 2026](https://www.primaralabs.com/tools/coa-reader) - [Delivery Checker Type a city or province to see Primara Labs' delivery window, courier, fee and cutoff there, with every covered area listed. Updated 23 September 2026](https://www.primaralabs.com/tools/delivery-checker) - [Supplier Checklist Ten checks to apply to any peptide seller in the Philippines, each with why it matters and how to check it, and how Primara answers every one. Updated 23 September 2026](https://www.primaralabs.com/tools/supplier-checklist) - [Lab Test Planner Pick a compound and a question, and see which laboratory tests answer it, what they cost and what the report will and will not tell you. Updated 23 September 2026](https://www.primaralabs.com/tools/lab-test-planner) How it works ## What the Research Desk does and does not do Trial figures come from the sponsor's release, the journal article or the trial registry. Compound identity comes from PubChem or the originating paper. A value that could not be confirmed from a fetched primary source is shown as "Not published" rather than estimated. The Desk describes research. It carries no dosing information of any kind and does not compare sellers. Everything Primara Labs supplies is for laboratory research use only. --- URL: https://www.primaralabs.com/data Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/data.md # Every dataset, as JSON and CSV. As of 23 September 2026, the Primara Research Desk publishes 9 datasets, each at a stable URL in JSON and CSV with a declared schema and a lastUpdated field. Free to reuse with a link to the source page. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 /data/evidence ## Evidence Map: human evidence for research peptides For each research compound in the Primara Labs catalogue: the highest level of human evidence found, the completed human randomised trials identified, what it is studied for, and the key source. 16 rows · last updated 23 September 2026 · [page](https://www.primaralabs.com/research/evidence) [Download JSON](https://www.primaralabs.com/data/evidence.json)[Download CSV](https://www.primaralabs.com/data/evidence.csv) | Field | Type | Description | | --- | --- | --- | | compound | string | Compound name. | | compoundId | string | Anchor on /research/evidence. | | alsoKnownAs | string | Other names. | | level | string | phase3, phase2, smallHuman, animalCell or none: the highest level of human evidence found. | | levelLabel | string | The level as the badge reads. | | humanRcts | integer | Completed human randomised controlled trials identified; see rctScope. | | rctScope | string | What the count includes. | | studiedFor | string | What the compound has been studied for, from the sources. | | basis | string | The trial or studies that set the level. | | keySource | string | Citation of the key source. | | rctSearchUrl | url | The Europe PMC query the count came from, where one was run. | | products | string | Primara Labs products that contain the compound. | | sourceUrl | url | The primary source the row was read from. | | checkedOn | date | ISO date the source was last read. | /data/benefits ## Benefits studied: research peptide findings by evidence level What research found for each compound, one finding per row, ordered strongest evidence first, each with its evidence level and primary source. Animal and cell findings are labelled as such. 60 rows · last updated 23 September 2026 · [page](https://www.primaralabs.com/research/evidence) [Download JSON](https://www.primaralabs.com/data/benefits.json)[Download CSV](https://www.primaralabs.com/data/benefits.csv) | Field | Type | Description | | --- | --- | --- | | compound | string | Compound name. | | compoundId | string | Compound id. | | order | integer | Position in the compound's benefits block, strongest evidence first. | | headline | string | Noun-phrase headline. | | evidence | string | phase3, phase2, smallHuman or animalCell. | | evidenceLabel | string | The badge text. | | finding | string | One third-person sentence stating the finding. | | sourceLabel | string | Citation. | | sourceUrl | url | The primary source the row was read from. | | checkedOn | date | ISO date the source was last read. | /data/compounds ## Research peptide compound profiles For each research compound in the Primara Labs catalogue: class, receptor targets or pathway, mechanism in plain language, and PubChem identity (CID, formula, weight, CAS, sequence), each field sourced and dated. 16 rows · last updated 23 September 2026 · [page](https://www.primaralabs.com/research/evidence) [Download JSON](https://www.primaralabs.com/data/compounds.json)[Download CSV](https://www.primaralabs.com/data/compounds.csv) | Field | Type | Description | | --- | --- | --- | | compound | string | Compound name. | | compoundId | string | Anchor on /research/evidence. | | compoundClass | string | Compound class. | | targets | string | Receptor targets or pathway. | | mechanism | string | Mechanism in plain language, from the row source. | | pubchemCid | integer | PubChem compound identifier. | | pubchemCidSourceUrl | url | Where pubchem cid was read. | | pubchemCidCheckedOn | date | ISO date pubchem cid was read. | | molecularFormula | string | Molecular formula as PubChem gives it. | | molecularFormulaSourceUrl | url | Where formula was read. | | molecularFormulaCheckedOn | date | ISO date formula was read. | | molecularWeight | number | g/mol as PubChem gives it. | | molecularWeightSourceUrl | url | Where molecular weight was read. | | molecularWeightCheckedOn | date | ISO date molecular weight was read. | | cas | string | CAS number, only where PubChem gives exactly one. | | casSourceUrl | url | Where cas was read. | | casCheckedOn | date | ISO date cas was read. | | sequence | string | Amino acid sequence where PubChem gives one. | | sequenceSourceUrl | url | Where sequence was read. | | sequenceCheckedOn | date | ISO date sequence was read. | | identityNote | string | Why an identity field is not published, where one is not. | | sourceUrl | url | The primary source the row was read from. | | checkedOn | date | ISO date the source was last read. | /data/trials ## Human trials of research peptides Human trials of compounds in the Primara Labs catalogue: phase, population, size, duration, primary endpoint, body-weight change by arm against comparator, discontinuation, registry ID and source. 40 rows · last updated 23 September 2026 · [page](https://www.primaralabs.com/research/trials) [Download JSON](https://www.primaralabs.com/data/trials.json)[Download CSV](https://www.primaralabs.com/data/trials.csv) | Field | Type | Description | | --- | --- | --- | | trial | string | Trial name. | | trialSlug | string | Page at /research/trials/. | | compound | string | Compound studied. | | phase | string | Trial phase. | | status | string | completed or ongoing. | | population | string | Who was enrolled. | | n | integer | Participants randomised, as the source states. | | weeks | integer | Duration of the reported endpoint. | | primaryEndpoint | string | As stated by the source. | | estimand | string | Which analysis the arm figures come from. | | outcome | string | What changePct measures: body weight unless stated. | | unit | string | Unit of changePct and comparatorChangePct: % or points. | | arm | string | Arm label as the source gives it. | | changePct | number | Mean change in the outcome, signed as reported (body weight in percent unless outcome says otherwise). | | comparator | string | Placebo or the named comparator. | | comparatorChangePct | number | Comparator's mean percent change, same estimand. | | discontinuationPct | number | Share of the arm who stopped because of adverse events. | | discontinuationComparatorPct | number | Same, comparator arm. | | registryId | string | ClinicalTrials.gov number. | | registryUrl | url | ClinicalTrials.gov record. | | readoutDate | date | Publication or announcement date of the results. | | sourceUrl | url | The primary source the row was read from. | | checkedOn | date | ISO date the source was last read. | /data/trial-adverse-events ## Adverse events in human trials of research peptides Adverse event and discontinuation rates by arm, with the comparator's rate, for every trial in the trials dataset that reports them. 122 rows · last updated 23 September 2026 · [page](https://www.primaralabs.com/research/trials) [Download JSON](https://www.primaralabs.com/data/trial-adverse-events.json)[Download CSV](https://www.primaralabs.com/data/trial-adverse-events.csv) | Field | Type | Description | | --- | --- | --- | | trial | string | Trial name. | | trialSlug | string | Page at /research/trials/. | | compound | string | Compound studied. | | event | string | Adverse event, or discontinuation for adverse events. | | arm | string | Arm label. | | pct | number | Share of the arm with the event. | | comparator | string | Placebo or the named comparator. | | comparatorPct | number | Share of the comparator arm with the event. | | sourceUrl | url | The primary source the row was read from. | | checkedOn | date | ISO date the source was last read. | /data/regulatory ## Regulatory status of research peptides For each research compound in the Primara Labs catalogue: status with FDA Philippines, the US FDA and the EMA, and the sponsor's stated next milestone, each sourced and dated. 16 rows · last updated 23 September 2026 · [page](https://www.primaralabs.com/research/status) [Download JSON](https://www.primaralabs.com/data/regulatory.json)[Download CSV](https://www.primaralabs.com/data/regulatory.csv) | Field | Type | Description | | --- | --- | --- | | compound | string | Compound name. | | compoundId | string | Anchor on /research/status. | | fdaPh | string | FDA Philippines: "Not approved", "Approved for ", "Investigational" or "No record found"; empty when it could not be established. | | fdaPhNote | string | Why a value is empty, or what the record covers. | | fdaPhSourceUrl | url | The record the status was read from. | | fdaPhCheckedOn | date | ISO date the record was read. | | usFda | string | US FDA: "Not approved", "Approved for ", "Investigational" or "No record found"; empty when it could not be established. | | usFdaNote | string | Why a value is empty, or what the record covers. | | usFdaSourceUrl | url | The record the status was read from. | | usFdaCheckedOn | date | ISO date the record was read. | | ema | string | EMA: "Not approved", "Approved for ", "Investigational" or "No record found"; empty when it could not be established. | | emaNote | string | Why a value is empty, or what the record covers. | | emaSourceUrl | url | The record the status was read from. | | emaCheckedOn | date | ISO date the record was read. | | nextMilestone | string | Next milestone: "Not approved", "Approved for ", "Investigational" or "No record found"; empty when it could not be established. | | nextMilestoneNote | string | Why a value is empty, or what the record covers. | | nextMilestoneSourceUrl | url | The record the status was read from. | | nextMilestoneCheckedOn | date | ISO date the record was read. | | sourceUrl | url | The primary source the row was read from. | | checkedOn | date | ISO date the source was last read. | /data/fda-ph-advisories ## FDA Philippines advisories naming research peptides FDA Philippines advisories that name a compound in the Primara Labs catalogue, with number, date, a one-sentence factual summary and a link. Only advisories that could be opened are listed. 8 rows · last updated 23 September 2026 · [page](https://www.primaralabs.com/research/status) [Download JSON](https://www.primaralabs.com/data/fda-ph-advisories.json)[Download CSV](https://www.primaralabs.com/data/fda-ph-advisories.csv) | Field | Type | Description | | --- | --- | --- | | number | string | Advisory number as published. | | date | date | Date of the advisory. | | compounds | string | Listed compounds the advisory names. | | summary | string | One factual sentence. | | sourceUrl | url | The primary source the row was read from. | | checkedOn | date | ISO date the source was last read. | /data/lab-tests ## Peptide laboratory tests and prices Tests a buyer can commission from independent analytical laboratories: what each covers, published US dollar price, turnaround and sample requirements, read from each laboratory's own site. 70 rows · last updated 23 September 2026 · [page](https://www.primaralabs.com/tools/lab-test-planner) [Download JSON](https://www.primaralabs.com/data/lab-tests.json)[Download CSV](https://www.primaralabs.com/data/lab-tests.csv) | Field | Type | Description | | --- | --- | --- | | laboratory | string | Laboratory name. | | test | string | Test as the laboratory names it. | | answers | string | Questions the test answers: identity, purity, quantity, endotoxin, heavyMetals, sterility. | | skus | string | Catalogue products a compound-specific test applies to; empty for general tests. | | covers | string | The laboratory's description. | | doesNotCover | string | Where the laboratory states a limit. | | priceUsd | number | Published price. | | priceUsdMin | number | Low end of a published range. | | priceUsdMax | number | High end of a published range. | | turnaround | string | As the laboratory states it. | | sampleRequirement | string | Sample requirement, as stated. | | blindTestingOffered | boolean | Whether the laboratory states it offers blind testing. | | sourceUrl | url | The primary source the row was read from. | | checkedOn | date | ISO date the source was last read. | /data/batch-reports ## Primara Labs batch reports Every laboratory report published for a Primara Labs batch: laboratory, test, what it covers and does not, result as printed, task number and verification key. 1 rows · last updated 23 September 2026 · [page](https://www.primaralabs.com/batch) [Download JSON](https://www.primaralabs.com/data/batch-reports.json)[Download CSV](https://www.primaralabs.com/data/batch-reports.csv) | Field | Type | Description | | --- | --- | --- | | batch | string | Batch as printed on the report and the vial. | | compound | string | Compound name. | | productSlug | string | Slug of the product page, /marketplace/. | | status | string | "Report issued" or "Submitted, report pending". | | laboratory | string | The laboratory that issued or holds the report. | | test | string | Test and method. | | covers | string | What the report covers. | | doesNotCover | string | What the report does not establish. | | result | number | The figure as printed on the report. | | resultUnit | string | Unit of the result, as printed. | | analysisDate | date | Analysis date printed on the report. | | task | string | The laboratory's task number. | | key | string | Verification key, as printed. | | verifyUrl | url | The laboratory's own verification page. | | batchUrl | url | The batch page on primaralabs.com, /batch/. | | coaUrl | url | The row on primaralabs.com/coa. | | sourceUrl | url | The primary source the row was read from. | | checkedOn | date | ISO date the source was last read. | Licence ## Licence Free to reuse with a link to the source page. Cite the dataset page, not the download, so readers reach the sources and dates behind each row. --- URL: https://www.primaralabs.com/research/evidence Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/evidence.md # How much human evidence, compound by compound. As of 23 September 2026, 5 of the 16 research compounds in the Primara Labs catalogue have at least one completed phase 3 human trial, 1 has phase 2 human evidence at most, 7 have only small human studies, and 3 have animal and cell evidence only. Each row gives the key source and, where one was run, the literature search behind the trial count. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 All compounds ## The map Highest human evidence16 of 16 rows *Human evidence by compound* | Compound | Highest human evidence | Human RCTs found | Studied for | Key source | | --- | --- | --- | --- | --- | | Retatrutide | Phase 3 human | 5 | obesity and overweight with a weight-related condition, type 2 diabetes, knee osteoarthritis pain, obstructive sleep apnoea, chronic low back pain, cardiovascular and renal outcomes, and fatty liver disease (MASLD) | [Eli Lilly, TRIUMPH-1 topline release, 21 May 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss) | | Tirzepatide | Phase 3 human | 5 | Obesity and overweight, obesity with type 2 diabetes, maintenance of weight reduction, and comparison with semaglutide | [Jastreboff AM et al. N Engl J Med 2022 (SURMOUNT-1)](https://doi.org/10.1056/NEJMoa2206038) | | Semaglutide | Phase 3 human | 7 | Obesity and overweight, obesity with type 2 diabetes, maintenance of weight reduction, and cardiovascular outcomes in people with cardiovascular disease | [Wilding JPH et al. N Engl J Med 2021 (STEP 1)](https://doi.org/10.1056/NEJMoa2032183) | | Tesamorelin | Phase 3 human | 10 | Excess visceral fat in people with HIV on antiretroviral therapy, fatty liver disease in HIV, abdominal obesity with reduced growth hormone secretion, and cognition in older adults | [Falutz J et al. N Engl J Med 2007](https://doi.org/10.1056/NEJMoa072375) | | Bremelanotide (PT-141) | Phase 3 human | 9 | Hypoactive sexual desire disorder in premenopausal women; earlier, sexual arousal disorder and erectile dysfunction; body weight in a phase 1 study | [Kingsberg SA et al. Obstet Gynecol 2019 (RECONNECT)](https://doi.org/10.1097/AOG.0000000000003500) | | Ipamorelin | Phase 2 human | 1 | Recovery of gut function after bowel surgery (phase 2); growth hormone release in healthy men; growth hormone release, bone growth and gut motility in animals | [Beck DE et al. Int J Colorectal Dis 2014 (phase 2)](https://doi.org/10.1007/s00384-014-2030-8) | | BPC-157 | Small human studies | 0 | Tendon, ligament and muscle healing and gastrointestinal injury in rats; interstitial cystitis and knee pain in small uncontrolled human reports | [Vasireddi N et al. HSS J 2025 (systematic review)](https://doi.org/10.1177/15563316251355551) | | GHK-Cu (copper tripeptide-1) | Small human studies | 2 | Diabetic foot ulcers and skin after laser resurfacing (small topical trials); cosmetic skin use; ligament and wound healing in animals; fibroblast growth in cell culture | [Pickart L et al. Biomed Res Int 2015 (review)](https://doi.org/10.1155/2015/648108) | | NAD+ (nicotinamide adenine dinucleotide) | Small human studies | 3 | Ischaemic heart failure (intravenous); blood NAD levels in healthy adults (oral and intravenous); heart and brain injury after blocked blood flow in animals | [Yu X et al. Am J Cardiovasc Drugs 2026](https://doi.org/10.1007/s40256-025-00764-7) | | CJC-1295 | Small human studies | 2 | Growth hormone and IGF-1 secretion in healthy adults; HIV-associated visceral obesity (phase 2, terminated) | [Teichman SL et al. J Clin Endocrinol Metab 2006](https://doi.org/10.1210/jc.2005-1536) | | Semax | Small human studies | 0 | Stroke and post-stroke rehabilitation, cerebrovascular insufficiency, optic nerve disease, motor neuron disease | [Dolotov OV et al. J Neurochem 2006](https://doi.org/10.1111/j.1471-4159.2006.03658.x) | | Selank | Small human studies | 0 | Generalised anxiety disorder and neurasthenia; anxiety-spectrum disorders alongside a benzodiazepine | [Russian comparative study, selank vs medazepam (Europe PMC 18454096)](https://europepmc.org/article/MED/18454096) | | DSIP (delta sleep-inducing peptide) | Small human studies | 2 | Chronic insomnia and sleep, withdrawal states (uncontrolled), pituitary hormones, and as an adjunct to anaesthesia | [Kovalzon VM, Strekalova TV. J Neurochem 2006 (review)](https://doi.org/10.1111/j.1471-4159.2006.03693.x) | | TB-500 (thymosin beta-4) | Animal and cell | 0 | Wound, corneal and tendon healing in animals (fragment and full-length protein); dry eye, corneal healing and skin ulcers in humans (full-length thymosin beta-4 only) | [Esposito S et al. Drug Test Anal 2012 (TB-500 identified as Ac-LKKTETQ)](https://doi.org/10.1002/dta.1402) | | KPV | Animal and cell | 0 | Colitis and colitis-associated tumours, peritoneal inflammation and oral mucositis in mice and rats; inflammatory signalling in cell culture | [Dalmasso G et al. Gastroenterology 2008](https://doi.org/10.1053/j.gastro.2007.10.026) | | MOTS-c | Animal and cell | 0 | Insulin resistance, diet-induced obesity, age-related physical decline and autoimmune diabetes in mice; circulating levels as a biomarker in people | [Lee C et al. Cell Metab 2015](https://doi.org/10.1016/j.cmet.2015.02.009) | The GLOW and KLOW blends are covered by their components' rows. The blends themselves have not been studied. [Download JSON](https://www.primaralabs.com/data/evidence.json)[Download CSV](https://www.primaralabs.com/data/evidence.csv) Metabolic ## Retatrutide Phase 3 human5 human RCTs found · Trials in the Research Desk trials dataset Retatrutide has four completed phase 3 trials, TRIUMPH-1 to TRIUMPH-4, reported by Eli Lilly between December 2025 and July 2026, and a phase 2 trial published in 2023. It is studied for obesity and overweight with a weight-related condition, type 2 diabetes, knee osteoarthritis pain, obstructive sleep apnoea, chronic low back pain, cardiovascular and renal outcomes, and fatty liver disease (MASLD). Further phase 3 trials are running, including TRIUMPH-5 against tirzepatide. Basis: Four completed phase 3 trials, TRIUMPH-1 to TRIUMPH-4 (Eli Lilly topline releases, December 2025 to July 2026), and a phase 2 trial (N Engl J Med 2023). Studied for: obesity and overweight with a weight-related condition, type 2 diabetes, knee osteoarthritis pain, obstructive sleep apnoea, chronic low back pain, cardiovascular and renal outcomes, and fatty liver disease (MASLD) Eli Lilly, TRIUMPH-1 topline release, 21 May 2026 [open](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss) · checked 23 September 2026 - [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) - [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) - [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) - [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) - [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) Metabolic ## Tirzepatide Phase 3 human5 human RCTs found · SURMOUNT obesity trials in the trials dataset; the wider literature, including diabetes trials, is larger Tirzepatide has five completed phase 3 obesity trials in the Research Desk dataset, SURMOUNT-1 to SURMOUNT-5, published between 2022 and 2025. SURMOUNT-5 compared it head to head with semaglutide in adults with obesity without type 2 diabetes. Its wider trial record, including its diabetes programme, is larger than this dataset holds. Basis: Completed phase 3 trials SURMOUNT-1 to SURMOUNT-4 and the phase 3b head-to-head SURMOUNT-5 against semaglutide. Studied for: Obesity and overweight, obesity with type 2 diabetes, maintenance of weight reduction, and comparison with semaglutide Jastreboff AM et al. N Engl J Med 2022 (SURMOUNT-1) [open](https://doi.org/10.1056/NEJMoa2206038) · checked 23 September 2026 - [SURMOUNT-1](https://www.primaralabs.com/research/trials/surmount-1) - [SURMOUNT-2](https://www.primaralabs.com/research/trials/surmount-2) - [SURMOUNT-3](https://www.primaralabs.com/research/trials/surmount-3) - [SURMOUNT-4](https://www.primaralabs.com/research/trials/surmount-4) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Tirzepatide 15mg](https://www.primaralabs.com/marketplace/tirzepatide-15mg) Metabolic ## Semaglutide Phase 3 human7 human RCTs found · STEP obesity trials and SELECT in the trials dataset; the wider literature, including diabetes trials, is larger Semaglutide at 2.4 mg has seven completed phase 3 trials in the Research Desk dataset: STEP 1 to STEP 5, STEP 8 and SELECT, published between 2021 and 2023. SELECT studied cardiovascular outcomes in people with cardiovascular disease and overweight or obesity without diabetes. Its wider trial record is larger than this dataset holds. Basis: Completed phase 3 trials STEP 1 to STEP 5 and STEP 8, and the cardiovascular outcomes trial SELECT. Studied for: Obesity and overweight, obesity with type 2 diabetes, maintenance of weight reduction, and cardiovascular outcomes in people with cardiovascular disease Wilding JPH et al. N Engl J Med 2021 (STEP 1) [open](https://doi.org/10.1056/NEJMoa2032183) · checked 23 September 2026 - [STEP 1](https://www.primaralabs.com/research/trials/step-1) - [STEP 2](https://www.primaralabs.com/research/trials/step-2) - [STEP 3](https://www.primaralabs.com/research/trials/step-3) - [STEP 4](https://www.primaralabs.com/research/trials/step-4) - [STEP 5](https://www.primaralabs.com/research/trials/step-5) - [STEP 8](https://www.primaralabs.com/research/trials/step-8) - [SELECT](https://www.primaralabs.com/research/trials/select) - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) Growth hormone axis ## Tesamorelin Phase 3 human10 human RCTs found · Completed human RCTs identified and screened in Europe PMC Tesamorelin, a synthetic analogue of growth hormone-releasing factor, has two completed phase 3 trials in adults with HIV and excess abdominal fat, published in 2007 and 2010. The Research Desk evidence pass identified ten completed human randomised controlled trials in all. A cognition result in older adults was not repeated in two later trials. Basis: Two completed phase 3 placebo-controlled trials in adults with HIV and abdominal fat accumulation (N Engl J Med 2007, n=412; J Acquir Immune Defic Syndr 2010, n=404). Studied for: Excess visceral fat in people with HIV on antiretroviral therapy, fatty liver disease in HIV, abdominal obesity with reduced growth hormone secretion, and cognition in older adults Falutz J et al. N Engl J Med 2007 [open](https://doi.org/10.1056/NEJMoa072375) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22tesamorelin%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [Tesamorelin phase 3 (Falutz, NEJM 2007)](https://www.primaralabs.com/research/trials/tesamorelin-phase-3-2007) - [Tesamorelin 10mg](https://www.primaralabs.com/marketplace/tesamorelin-10mg) Melanocortin ## Bremelanotide (PT-141) Phase 3 human9 human RCTs found · Completed human RCTs identified and screened in Europe PMC Bremelanotide (sold as PT-141) is a melanocortin receptor agonist with two completed phase 3 trials, RECONNECT 301 and 302, in 1,267 premenopausal women with hypoactive sexual desire disorder, published in 2019. The evidence pass identified nine completed human randomised controlled trials. A trial in men with erectile dysfunction carries a published expression of concern and is not counted. Basis: Two identical completed phase 3 trials, RECONNECT studies 301 and 302 (Obstet Gynecol 2019; 1,267 premenopausal women with hypoactive sexual desire disorder). Studied for: Hypoactive sexual desire disorder in premenopausal women; earlier, sexual arousal disorder and erectile dysfunction; body weight in a phase 1 study Kingsberg SA et al. Obstet Gynecol 2019 (RECONNECT) [open](https://doi.org/10.1097/AOG.0000000000003500) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22bremelanotide%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [RECONNECT (studies 301 and 302)](https://www.primaralabs.com/research/trials/reconnect) - [PT-141 10mg](https://www.primaralabs.com/marketplace/pt-141-10mg) Growth hormone axis ## Ipamorelin Phase 2 human1 human RCT found · Completed human RCTs identified and screened in Europe PMC Ipamorelin, a synthetic growth hormone secretagogue, has one completed phase 2 human trial, in patients recovering from bowel resection, and it found no significant difference from placebo. Other human data are pharmacology studies of growth hormone release in healthy men. Most of its literature is animal work. Basis: One completed phase 2 placebo-controlled trial in postoperative ileus (n=117), which found no significant difference from placebo. Studied for: Recovery of gut function after bowel surgery (phase 2); growth hormone release in healthy men; growth hormone release, bone growth and gut motility in animals Beck DE et al. Int J Colorectal Dis 2014 (phase 2) [open](https://doi.org/10.1007/s00384-014-2030-8) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22ipamorelin%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [CJC-1295 / Ipamorelin 5mg + 5mg](https://www.primaralabs.com/marketplace/cjc-1295-ipamorelin-10mg) Tissue repair ## BPC-157 Small human studies0 human RCTs found · Completed human RCTs identified and screened in Europe PMC and ClinicalTrials.gov BPC-157 has no completed human randomised controlled trial. Its human data are three small uncontrolled reports of 2 to 16 people, and a 2025 systematic review found no clinical safety data. Almost all of its literature is rat work on tendon, ligament and gut healing. Basis: Three small uncontrolled human reports only: a 2-person intravenous safety pilot, a 12-patient interstitial cystitis pilot and a 16-patient retrospective knee-pain survey. No completed human randomised trial and no registered trial with results were found. Studied for: Tendon, ligament and muscle healing and gastrointestinal injury in rats; interstitial cystitis and knee pain in small uncontrolled human reports Vasireddi N et al. HSS J 2025 (systematic review) [open](https://doi.org/10.1177/15563316251355551) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22BPC-157%22%20OR%20TITLE_ABS%3A%22BPC%20157%22%20OR%20TITLE_ABS%3A%22body%20protection%20compound%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [BPC-157 20mg](https://www.primaralabs.com/marketplace/bpc-157-20mg) - [GLOW Blend 70mg](https://www.primaralabs.com/marketplace/glow-blend-70mg) - [KLOW Blend 80mg](https://www.primaralabs.com/marketplace/klow-blend-80mg) Tissue repair ## GHK-Cu (copper tripeptide-1) Small human studies2 human RCTs found · Completed human RCTs identified and screened in Europe PMC; both topical GHK-Cu is a copper-binding tripeptide found in human plasma. Its human evidence is two small topical trials, one in diabetic foot ulcers from 1994 and one after laser skin resurfacing that found no objective benefit; a 2025 review notes a surprising absence of clinical studies. Most of its literature is cell and animal work. Basis: Two small randomised trials of topical GHK-Cu: a 1994 diabetic ulcer trial whose size and phase the abstract does not give, and a 13-patient trial after laser resurfacing with no objective benefit. Studied for: Diabetic foot ulcers and skin after laser resurfacing (small topical trials); cosmetic skin use; ligament and wound healing in animals; fibroblast growth in cell culture Pickart L et al. Biomed Res Int 2015 (review) [open](https://doi.org/10.1155/2015/648108) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22GHK-Cu%22%20OR%20TITLE_ABS%3A%22GHK-copper%22%20OR%20TITLE_ABS%3A%22copper%20tripeptide%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [GHK-Cu 50mg](https://www.primaralabs.com/marketplace/ghk-cu-50mg) - [GLOW Blend 70mg](https://www.primaralabs.com/marketplace/glow-blend-70mg) - [KLOW Blend 80mg](https://www.primaralabs.com/marketplace/klow-blend-80mg) Cellular ## NAD+ (nicotinamide adenine dinucleotide) Small human studies3 human RCTs found · Completed human RCTs of NAD+ itself identified in Europe PMC; precursor trials excluded NAD+ is a coenzyme central to cellular energy metabolism. Three small randomised trials have given NAD+ itself to people, the largest an intravenous trial in 180 adults with ischaemic heart failure; none is a phase 2 or phase 3 trial. Most human research on raising NAD uses precursors such as NR and NMN, which are different molecules. Basis: Three randomised trials of NAD+ itself, none labelled phase 2 or 3: an intravenous trial in 180 adults with ischaemic heart failure, an oral-formulation biomarker trial (60 randomised) and an 11-person intravenous pilot. Trials of precursors such as NR and NMN are excluded. Studied for: Ischaemic heart failure (intravenous); blood NAD levels in healthy adults (oral and intravenous); heart and brain injury after blocked blood flow in animals Yu X et al. Am J Cardiovasc Drugs 2026 [open](https://doi.org/10.1007/s40256-025-00764-7) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22NAD%2B%22%20OR%20TITLE_ABS%3A%22nicotinamide%20adenine%20dinucleotide%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22)&resultType=core&format=json&pageSize=50) - [NAD+ 1000mg](https://www.primaralabs.com/marketplace/nad-1000mg) Growth hormone axis ## CJC-1295 Small human studies2 human RCTs found · Completed human RCTs identified and screened in Europe PMC; both are pharmacology trials CJC-1295 is a long-acting analogue of growth hormone-releasing hormone. Its human evidence is two small randomised pharmacology trials in healthy adults, published in 2006, that measured growth hormone and IGF-1 rather than a clinical outcome. The human data are for the albumin-binding (DAC) form; no human trial of the form without DAC was found. Basis: Two small randomised, placebo-controlled, ascending-dose trials in healthy adults (J Clin Endocrinol Metab 2006) with growth hormone and IGF-1 readouts only; a phase 2 trial in HIV was terminated without results. Studied for: Growth hormone and IGF-1 secretion in healthy adults; HIV-associated visceral obesity (phase 2, terminated) Teichman SL et al. J Clin Endocrinol Metab 2006 [open](https://doi.org/10.1210/jc.2005-1536) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22CJC-1295%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [CJC-1295 / Ipamorelin 5mg + 5mg](https://www.primaralabs.com/marketplace/cjc-1295-ipamorelin-10mg) Neuropeptide ## Semax Small human studies0 human RCTs found · No study meeting the randomised-trial rule was found; the literature is mostly Russian and only English abstracts were read Semax is a synthetic heptapeptide derived from a fragment of ACTH. Its human evidence is small Russian clinical studies, none confirmed as randomised in the abstracts indexed by Europe PMC, mostly in stroke and cerebrovascular disease. Its mechanism is described from rat work on BDNF signalling. Basis: Small Russian clinical studies, open-label or with non-randomised comparison groups (stroke rehabilitation, acute stroke, motor neuron disease), and one small placebo-comparison imaging study in healthy volunteers. Studied for: Stroke and post-stroke rehabilitation, cerebrovascular insufficiency, optic nerve disease, motor neuron disease Dolotov OV et al. J Neurochem 2006 [open](https://doi.org/10.1111/j.1471-4159.2006.03658.x) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22semax%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [Semax 10mg](https://www.primaralabs.com/marketplace/semax-10mg) Neuropeptide ## Selank Small human studies0 human RCTs found · No study meeting the randomised-trial rule was found; the literature is mostly Russian and only English abstracts were read Selank is a synthetic heptapeptide studied in Russia for anxiety disorders. Its human evidence is small comparative studies against benzodiazepines without a placebo arm or stated random allocation. Its proposed mechanisms, GABA receptor modulation and enkephalinase inhibition, come from laboratory work. Basis: Small Russian comparative studies in anxiety disorders against benzodiazepines (n=60 to 70), with no placebo arm and random allocation not stated in the abstracts. Studied for: Generalised anxiety disorder and neurasthenia; anxiety-spectrum disorders alongside a benzodiazepine Russian comparative study, selank vs medazepam (Europe PMC 18454096) [open](https://europepmc.org/article/MED/18454096) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22selank%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [Selank 10mg](https://www.primaralabs.com/marketplace/selank-10mg) Neuropeptide ## DSIP (delta sleep-inducing peptide) Small human studies2 human RCTs found · Completed human RCTs identified and screened in Europe PMC; neither measured a sleep outcome Delta sleep-inducing peptide is a nine-residue peptide with no identified gene, precursor or receptor, so its mechanism is unknown. Its human evidence is small studies from 1981 to 2009, with sleep results its own authors described as weak and conflicting. Basis: Small human studies from 1981 to 2009 (n=6 to 24): two with stated random allocation, measuring anaesthesia depth and ACTH, and several placebo-controlled insomnia studies with mixed results. Studied for: Chronic insomnia and sleep, withdrawal states (uncontrolled), pituitary hormones, and as an adjunct to anaesthesia Kovalzon VM, Strekalova TV. J Neurochem 2006 (review) [open](https://doi.org/10.1111/j.1471-4159.2006.03693.x) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22delta%20sleep-inducing%20peptide%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [DSIP 10mg](https://www.primaralabs.com/marketplace/dsip-10mg) Tissue repair ## TB-500 (thymosin beta-4) Animal and cell0 human RCTs found · For the TB-500 fragment. Ten completed human RCTs exist for full-length thymosin beta-4, a different molecule No human trial of TB-500, the acetylated thymosin beta-4 fragment Ac-LKKTETQ, has reported; its evidence is animal and cell work. Full-length thymosin beta-4 has been studied in people, mostly as eye drops, where two phase 3 dry-eye trials posted near-identical results in both arms. A 2024 cell study found the wound-healing activity came from a TB-500 breakdown product rather than TB-500 itself. Basis: TB-500 is identified in the analytical literature as the acetylated thymosin beta-4 fragment Ac-LKKTETQ, which has animal and cell data only; one human trial is recruiting. Full-length thymosin beta-4 has human trials, mostly as eye drops: two phase 3 dry-eye trials posted near-identical results in both arms and a small phase 3 corneal trial stopped early without a significant result. Studied for: Wound, corneal and tendon healing in animals (fragment and full-length protein); dry eye, corneal healing and skin ulcers in humans (full-length thymosin beta-4 only) Esposito S et al. Drug Test Anal 2012 (TB-500 identified as Ac-LKKTETQ) [open](https://doi.org/10.1002/dta.1402) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22TB-500%22%20OR%20TITLE_ABS%3A%22TB500%22%20OR%20TITLE_ABS%3A%22thymosin%20beta-4%22%20OR%20TITLE_ABS%3A%22thymosin%20beta%204%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [TB-500 10mg](https://www.primaralabs.com/marketplace/tb-500-10mg) - [GLOW Blend 70mg](https://www.primaralabs.com/marketplace/glow-blend-70mg) - [KLOW Blend 80mg](https://www.primaralabs.com/marketplace/klow-blend-80mg) Tissue repair ## KPV Animal and cell0 human RCTs found · Completed human RCTs identified and screened in Europe PMC and ClinicalTrials.gov KPV is the three-amino-acid tail (Lys-Pro-Val) of alpha-melanocyte-stimulating hormone. It has never been given to people in a published study; its evidence is mouse, rat and cell work, mostly in colitis models. Basis: Mouse, rat and cell-culture studies only (colitis, peritonitis, oral mucositis), plus one test-tube study on blood samples from people with HIV. No human administration study and no registered trial. Studied for: Colitis and colitis-associated tumours, peritoneal inflammation and oral mucositis in mice and rats; inflammatory signalling in cell culture Dalmasso G et al. Gastroenterology 2008 [open](https://doi.org/10.1053/j.gastro.2007.10.026) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22KPV%22%20OR%20TITLE_ABS%3A%22Lys-Pro-Val%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [KLOW Blend 80mg](https://www.primaralabs.com/marketplace/klow-blend-80mg) Cellular ## MOTS-c Animal and cell0 human RCTs found · Completed human RCTs identified and screened in Europe PMC and ClinicalTrials.gov MOTS-c is a 16-amino-acid peptide encoded in mitochondrial DNA. No published study has given it to people; its evidence is mouse and cell work on insulin sensitivity and physical capacity. A phase 2a human trial was recruiting when checked. Basis: No published human study has given MOTS-c; human papers measure the body's own levels. A phase 1 trial of the analogue CB4211 completed in 2021 without posted results, and a phase 2a trial of MOTS-c is recruiting. Studied for: Insulin resistance, diet-induced obesity, age-related physical decline and autoimmune diabetes in mice; circulating levels as a biomarker in people Lee C et al. Cell Metab 2015 [open](https://doi.org/10.1016/j.cmet.2015.02.009) · checked 23 September 2026 · [Europe PMC search behind the count](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=(TITLE_ABS%3A%22MOTS-c%22%20OR%20TITLE_ABS%3A%22MOTSc%22)%20AND%20(PUB_TYPE%3A%22Randomized%20Controlled%20Trial%22%20OR%20TITLE_ABS%3A%22randomized%22%20OR%20TITLE_ABS%3A%22randomised%22)&resultType=core&format=json&pageSize=50) - [MOTS-c 10mg](https://www.primaralabs.com/marketplace/mots-c-10mg) Method ## How the levels are assigned Methodology Phase 3 human means at least one completed phase 3 trial in people exists; it says nothing about whether that trial was positive, which each row states. Phase 2 human, small human studies and animal and cell follow the same rule: the highest level of evidence found, not an average. A study counts as a human randomised controlled trial only when its abstract states random allocation to a controlled comparison. Reviews, protocols, secondary analyses and retracted or flagged papers are not counted. Trials of related molecules (precursors, fragments, analogues) are named in the row and not counted for the compound. Searches ran on Europe PMC and ClinicalTrials.gov. Russian-language literature was read from English abstracts only. Cite this Primara Labs Research Desk, "Evidence Map: human evidence for research peptides", last updated 23 September 2026, https://www.primaralabs.com/research/evidence --- URL: https://www.primaralabs.com/research/trials Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials.md # Human trials, arm by arm. As of 23 September 2026, the Primara Research Desk lists 25 human trials of compounds in the Primara Labs catalogue: 19 completed with published results and 6 still running. Each row gives the phase, population, size, duration, mean body-weight change by arm against the comparator, and the source it was read from. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 All trials ## Every trial in the dataset CompoundPhaseStatusPopulation25 of 25 rows *Human trials, one row per trial* | Trial | Compound | Phase | Status | Population | n | Weeks | Largest arm change (body weight unless noted) | Comparator | Estimand | Read out | | --- | --- | --- | --- | --- | --- | --- | --- | --- | --- | --- | | [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) | Retatrutide | Phase 3 | Ongoing | Adults who have obesity | Not published | Not published | Not reported | Not reported | Not stated | Not reported | | [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) | Retatrutide | Phase 3 | Ongoing | Adults with obesity | Not published | Not published | Not reported | Not reported | Not stated | Not reported | | [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) | Retatrutide | Phase 3 | Ongoing | Adults with obesity or overweight and chronic low back pain | Not published | Not published | Not reported | Not reported | Not stated | Not reported | | [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) | Retatrutide | Phase 3 | Ongoing | Adults with obesity or overweight | Not published | Not published | Not reported | Not reported | Not stated | Not reported | | [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) | Retatrutide | Phase 3 | Ongoing | Adults without type 2 diabetes who have obesity or overweight | Not published | Not published | Not reported | Not reported | Not stated | Not reported | | [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) | Retatrutide | Phase 3 | Ongoing | Adults living with obesity | Not published | Not published | Not reported | Not reported | Not stated | Not reported | | [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) | Retatrutide | Phase 3 | Completed | Adults with type 2 diabetes and obesity or overweight | 1,152 | 80 | \-20.8% (12 mg) | \-4.0% | efficacy | 23 July 2026 | | [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) | Retatrutide | Phase 3 | Completed | Adults with severe obesity (BMI of 35 or more) and established cardiovascular disease, with or without type 2 diabetes | 1,949 | 80 | \-22.6% (12 mg) | \-3.2% | efficacy | 23 July 2026 | | [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) | Retatrutide | Phase 3 | Completed | Adults with obesity, or overweight with at least one weight-related condition, without diabetes | 2,339 | 80 | \-28.3% (12 mg) | \-2.2% | efficacy | 21 May 2026 | | [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) | Retatrutide | Phase 3 | Completed | Adults with obesity or overweight and knee osteoarthritis, without diabetes | 445 | 68 | \-28.7% (12 mg) | \-2.1% | efficacy | 11 December 2025 | | [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) | Tirzepatide | Phase 3b | Completed | Adults with obesity but without type 2 diabetes | 751 | 72 | \-20.2% (Tirzepatide, maximum tolerated dose) | \-13.7% | Not stated | 11 May 2025 | | [SURMOUNT-4](https://www.primaralabs.com/research/trials/surmount-4) | Tirzepatide | Phase 3 | Completed | Adults with BMI of 30 or more, or 27 or more with a weight-related complication, excluding diabetes | 670 | 88 | \-5.5% (Continued tirzepatide, weeks 36 to 88) | +14.0% | treatment-regimen | 1 January 2024 | | [SELECT](https://www.primaralabs.com/research/trials/select) | Semaglutide | Phase 3 | Completed | Patients 45 years or older with preexisting cardiovascular disease and BMI of 27 or greater, no history of diabetes | 17,604 | Not published | Not reported | Not reported | Not stated | 11 November 2023 | | [SURMOUNT-3](https://www.primaralabs.com/research/trials/surmount-3) | Tirzepatide | Phase 3 | Completed | Adults with BMI of 30 or more, or 27 or more with at least one obesity-related complication (excluding diabetes), who achieved 5.0% or more weight reduction after a 12-week intensive lifestyle intervention | 579 | 72 | \-18.4% (Maximum tolerated dose (10 or 15 mg)) | +2.5% | treatment-regimen | 15 October 2023 | | [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) | Retatrutide | Phase 2 | Completed | Adults with a BMI of 30 or more, or 27 to under 30 with at least one weight-related condition | 338 | 48 | \-24.2% (12 mg) | \-2.1% | Not stated | 26 June 2023 | | [SURMOUNT-2](https://www.primaralabs.com/research/trials/surmount-2) | Tirzepatide | Phase 3 | Completed | Adults (18 or older) with BMI of 27 kg/m2 or higher and type 2 diabetes with HbA1c 7-10% (53-86 mmol/mol), in seven countries | 938 | 72 | \-14.7% (15 mg) | \-3.2% | treatment-regimen | 26 June 2023 | | [STEP 5](https://www.primaralabs.com/research/trials/step-5) | Semaglutide | Phase 3 | Completed | Adults with obesity, or overweight with at least one weight-related comorbidity, without diabetes | 304 | 104 | \-15.2% (2.4 mg) | \-2.6% | treatment-policy | 10 October 2022 | | [SURMOUNT-1](https://www.primaralabs.com/research/trials/surmount-1) | Tirzepatide | Phase 3 | Completed | Adults with BMI of 30 or more, or 27 or more with at least one weight-related complication, excluding diabetes | 2,539 | 72 | \-20.9% (15 mg) | \-3.1% | treatment-regimen | 4 June 2022 | | [STEP 8](https://www.primaralabs.com/research/trials/step-8) | Semaglutide | Phase 3b | Completed | US adults with BMI of 30 or greater, or 27 or greater with 1 or more weight-related comorbidities, without diabetes | 338 | 68 | \-15.8% (Semaglutide 2.4 mg) | \-1.9% | treatment-policy | 1 January 2022 | | [STEP 3](https://www.primaralabs.com/research/trials/step-3) | Semaglutide | Phase 3 | Completed | US adults without diabetes with overweight (BMI 27 or greater) plus at least 1 comorbidity or obesity (BMI 30 or greater) | 611 | 68 | \-16.0% (2.4 mg) | \-5.7% | treatment-policy | 1 April 2021 | | [STEP 4](https://www.primaralabs.com/research/trials/step-4) | Semaglutide | Phase 3 | Completed | Adults with BMI of at least 30 (or 27 or greater with at least 1 weight-related comorbidity) without diabetes, who reached the 2.4 mg maintenance dose during a 20-week run-in | 803 | 68 | \-7.9% (Continued 2.4 mg, weeks 20 to 68) | +6.9% | treatment-policy | 1 April 2021 | | [STEP 2](https://www.primaralabs.com/research/trials/step-2) | Semaglutide | Phase 3 | Completed | Adults with BMI of at least 27 kg/m2 and HbA1c 7-10% (53-86 mmol/mol), diagnosed with type 2 diabetes at least 180 days before screening | 1,210 | 68 | \-9.6% (2.4 mg) | \-3.4% | Not stated | 2 March 2021 | | [STEP 1](https://www.primaralabs.com/research/trials/step-1) | Semaglutide | Phase 3 | Completed | Adults with BMI of 30 or greater (27 or greater with at least one weight-related coexisting condition), without diabetes | 1,961 | 68 | \-14.9% (2.4 mg) | \-2.4% | treatment-policy | 10 February 2021 | | [RECONNECT (studies 301 and 302)](https://www.primaralabs.com/research/trials/reconnect) | Bremelanotide | Phase 3 | Completed | Premenopausal women with hypoactive sexual desire disorder | 1,267 | 24 | +0.42 points (Study 302, 1.75 mg), FSFI desire domain score difference from placebo | Not reported | Not stated | 1 November 2019 | | [Tesamorelin phase 3 (Falutz, NEJM 2007)](https://www.primaralabs.com/research/trials/tesamorelin-phase-3-2007) | Tesamorelin | Phase 3 | Completed | Adults with HIV and abdominal fat accumulation (86% men) | 412 | 26 | \-15.2% (2 mg), Visceral adipose tissue | +5.0% | Not stated | 1 December 2007 | [Download JSON](https://www.primaralabs.com/data/trials.json)[Download CSV](https://www.primaralabs.com/data/trials.csv) [Download JSON](https://www.primaralabs.com/data/trial-adverse-events.json)[Download CSV](https://www.primaralabs.com/data/trial-adverse-events.csv) Compare ## Compare two to four trials Choose two to four trials 2 selected. Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. | | [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) | [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) | | --- | --- | --- | | Compound | Retatrutide | Retatrutide | | Phase | 3 | 3 | | Population | Adults with obesity, or overweight with at least one weight-related condition, without diabetes | Adults with type 2 diabetes and obesity or overweight | | n | 2,339 | 1,152 | | Weeks | 80 | 80 | | Estimand | efficacy | efficacy | | Arms | 4 mg: -19.0%; 9 mg: -25.9%; 12 mg: -28.3% | 4 mg: -12.7%; 9 mg: -19.1%; 12 mg: -20.8% | | Comparator | Placebo: -2.2% | Placebo: -4.0% | | Stopped for adverse events | 4 mg: 4.1%; 9 mg: 6.9%; 12 mg: 11.3%; Placebo: 4.9% | 4 mg: 3.8%; 9 mg: 11.6%; 12 mg: 7.7%; Placebo: 4.9% | | Source | Eli Lilly topline release, 21 May 2026 | Eli Lilly topline release, 23 July 2026 | Side-by-side figures from different trials are not a head-to-head result. The only direct comparisons among these compounds are head-to-head trials: [Retatrutide vs tirzepatide](https://www.primaralabs.com/research/compare/retatrutide-vs-tirzepatide), [Tirzepatide vs semaglutide](https://www.primaralabs.com/research/compare/tirzepatide-vs-semaglutide), [Retatrutide vs semaglutide](https://www.primaralabs.com/research/compare/retatrutide-vs-semaglutide). Method ## How the dataset is built Methodology Trial results come only from the sponsor's release, the journal article or the ClinicalTrials.gov record. Each trial records which estimand its arm figures use: sponsor releases usually lead with the efficacy estimand, which assumes participants stayed on treatment; journal abstracts usually report the treatment-policy or treatment-regimen estimand, which counts everyone randomised and runs lower. A figure the source does not state is shown as "Not published". Arm doses are given only as the label of the arm the trial studied. The Research Desk carries no dosing information. Cite this Primara Labs Research Desk, "Human trials of research peptides", last updated 23 September 2026, https://www.primaralabs.com/research/trials --- URL: https://www.primaralabs.com/research/status Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/status.md # Approved where, and for what. As of 23 September 2026, this tracker records the status of each research compound in the Primara Labs catalogue with FDA Philippines, the US Food and Drug Administration and the European Medicines Agency, each read from the authority's own database or the sponsor's own statement. An approval applies to a named medicine for a named indication; it never makes a research vial an approved product. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 All compounds ## Status by authority FDA PhilippinesUS FDAEMA16 of 16 rows *Regulatory status by compound* | Compound | FDA Philippines | US FDA | EMA | Sponsor's next milestone | | --- | --- | --- | --- | --- | | Retatrutide | Not established | Investigational | No record found | Sponsor plans a US Biologics License Application submission in Q1 2027 | | Tirzepatide | Not established | Approved for glycemic control in type 2 diabetes mellitus (Mounjaro); weight reduction in obesity or overweight with a comorbidity and moderate to severe obstructive sleep apnea in adults with obesity (Zepbound) | Approved for type 2 diabetes mellitus and weight management (Mounjaro) | None published | | Semaglutide | Not established | Approved for glycemic control in type 2 diabetes mellitus and related cardiovascular and kidney risk reduction (Ozempic, Rybelsus); chronic weight management and cardiovascular risk reduction in obesity or overweight (Wegovy) | Approved for type 2 diabetes mellitus (Ozempic, Rybelsus), weight management (Wegovy) and non-cirrhotic MASH with F2 to F3 fibrosis (Kayshild) | None published | | BPC-157 | Not established | No record found | No record found | None published | | TB-500 (thymosin beta-4) | Not established | No record found | No record found | None published | | GHK-Cu (copper tripeptide-1) | Not established | No record found | No record found | None published | | KPV | Not established | No record found | No record found | None published | | NAD+ (nicotinamide adenine dinucleotide) | Not established | No record found | No record found | None published | | MOTS-c | Not established | No record found | No record found | None published | | Tesamorelin | Not established | Approved for reduction of excess abdominal fat in HIV-infected adult patients with lipodystrophy | Not approved | None published | | CJC-1295 | Not established | No record found | No record found | None published | | Ipamorelin | Not established | No record found | No record found | None published | | Bremelanotide (PT-141) | Not established | Approved for acquired, generalized hypoactive sexual desire disorder (HSDD) in premenopausal women | No record found | None published | | Semax | Not established | No record found | No record found | None published | | Selank | Not established | No record found | No record found | None published | | DSIP (delta sleep-inducing peptide) | Not established | No record found | No record found | None published | [Download JSON](https://www.primaralabs.com/data/regulatory.json)[Download CSV](https://www.primaralabs.com/data/regulatory.csv) Metabolic ## Is Retatrutide approved in the Philippines? Retatrutide: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "Investigational". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA Investigational Eli Lilly's release of 23 July 2026 describes retatrutide as investigational. Drugs@FDA returned no approved application. [Source](https://lilly.mediaroom.com/2026-07-23-Lillys-triple-agonist,-retatrutide,-successful-in-two-additional-Phase-3-obesity-trials,-delivering-significant-improvements-in-weight-and-A1C) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Sponsor plans a US Biologics License Application submission in Q1 2027 Eli Lilly press release dated 23 July 2026. [Source](https://lilly.mediaroom.com/2026-07-23-Lillys-triple-agonist,-retatrutide,-successful-in-two-additional-Phase-3-obesity-trials,-delivering-significant-improvements-in-weight-and-A1C) · checked 23 September 2026 - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) Metabolic ## Is Tirzepatide approved in the Philippines? Tirzepatide: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "Approved for glycemic control in type 2 diabetes mellitus (Mounjaro); weight reduction in obesity or overweight with a comorbidity and moderate to severe obstructive sleep apnea in adults with obesity (Zepbound)". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA Approved for glycemic control in type 2 diabetes mellitus (Mounjaro); weight reduction in obesity or overweight with a comorbidity and moderate to severe obstructive sleep apnea in adults with obesity (Zepbound) Drugs@FDA: Mounjaro (NDA215866, approved 13 May 2022); Zepbound (NDA217806, approved 8 November 2023). The approval covers the named branded medicine for its labelled use only, never a research-grade vial of the same substance. [Source](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=215866) · checked 23 September 2026 EMA Approved for type 2 diabetes mellitus and weight management (Mounjaro) Mounjaro, EMEA/H/C/005620, authorised 15 September 2022. The authorisation covers the named medicine only. [Source](https://www.ema.europa.eu/en/medicines/human/EPAR/mounjaro) · checked 23 September 2026 Sponsor's next milestone Not established None sought: an approved medicine already exists. Not published - [Evidence Map: Tirzepatide](https://www.primaralabs.com/research/evidence#tirzepatide) - [Tirzepatide 15mg](https://www.primaralabs.com/marketplace/tirzepatide-15mg) Metabolic ## Is Semaglutide approved in the Philippines? Semaglutide: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "Approved for glycemic control in type 2 diabetes mellitus and related cardiovascular and kidney risk reduction (Ozempic, Rybelsus); chronic weight management and cardiovascular risk reduction in obesity or overweight (Wegovy)". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA Approved for glycemic control in type 2 diabetes mellitus and related cardiovascular and kidney risk reduction (Ozempic, Rybelsus); chronic weight management and cardiovascular risk reduction in obesity or overweight (Wegovy) Drugs@FDA: Ozempic (NDA209637, approved 5 December 2017); WEGOVY (injection) (NDA215256, approved 4 June 2021); RYBELSUS / OZEMPIC (tablets) (NDA213051, approved 20 September 2019); Rybelsus (NDA213182, approved 16 January 2020); WEGOVY (tablets) (NDA218316, approved 22 December 2025). The approval covers the named branded medicine for its labelled use only, never a research-grade vial of the same substance. [Source](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=209637) · checked 23 September 2026 EMA Approved for type 2 diabetes mellitus (Ozempic, Rybelsus), weight management (Wegovy) and non-cirrhotic MASH with F2 to F3 fibrosis (Kayshild) Five authorised products containing semaglutide, all held by Novo Nordisk A/S. The authorisation covers the named medicines only. [Source](https://www.ema.europa.eu/en/medicines/human/EPAR/ozempic) · checked 23 September 2026 Sponsor's next milestone Not established None sought: an approved medicine already exists. Not published - [Evidence Map: Semaglutide](https://www.primaralabs.com/research/evidence#semaglutide) - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) Tissue repair ## Is BPC-157 approved in the Philippines? BPC-157: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "No record found". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22BPC-157%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established No sponsor identified in any record read. Not published - [Evidence Map: BPC-157](https://www.primaralabs.com/research/evidence#bpc-157) - [BPC-157 20mg](https://www.primaralabs.com/marketplace/bpc-157-20mg) - [GLOW Blend 70mg](https://www.primaralabs.com/marketplace/glow-blend-70mg) - [KLOW Blend 80mg](https://www.primaralabs.com/marketplace/klow-blend-80mg) Tissue repair ## Is TB-500 approved in the Philippines? TB-500: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "No record found". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22thymosin%20beta-4%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established No sponsor identified in any record read. Not published - [Evidence Map: TB-500](https://www.primaralabs.com/research/evidence#tb-500) - [TB-500 10mg](https://www.primaralabs.com/marketplace/tb-500-10mg) - [GLOW Blend 70mg](https://www.primaralabs.com/marketplace/glow-blend-70mg) - [KLOW Blend 80mg](https://www.primaralabs.com/marketplace/klow-blend-80mg) Tissue repair ## Is GHK-Cu approved in the Philippines? GHK-Cu: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "No record found". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22GHK-Cu%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established No sponsor identified in any record read. Not published - [Evidence Map: GHK-Cu](https://www.primaralabs.com/research/evidence#ghk-cu) - [GHK-Cu 50mg](https://www.primaralabs.com/marketplace/ghk-cu-50mg) - [GLOW Blend 70mg](https://www.primaralabs.com/marketplace/glow-blend-70mg) - [KLOW Blend 80mg](https://www.primaralabs.com/marketplace/klow-blend-80mg) Tissue repair ## Is KPV approved in the Philippines? KPV: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "No record found". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22KPV%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established No sponsor identified in any record read. Not published - [Evidence Map: KPV](https://www.primaralabs.com/research/evidence#kpv) - [KLOW Blend 80mg](https://www.primaralabs.com/marketplace/klow-blend-80mg) Cellular ## Is NAD+ approved in the Philippines? NAD+: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "No record found". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22NAD%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established No sponsor identified in any record read. Not published - [Evidence Map: NAD+](https://www.primaralabs.com/research/evidence#nad) - [NAD+ 1000mg](https://www.primaralabs.com/marketplace/nad-1000mg) Cellular ## Is MOTS-c approved in the Philippines? MOTS-c: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "No record found". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22MOTS-c%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established No sponsor identified in any record read. Not published - [Evidence Map: MOTS-c](https://www.primaralabs.com/research/evidence#mots-c) - [MOTS-c 10mg](https://www.primaralabs.com/marketplace/mots-c-10mg) Growth hormone axis ## Is Tesamorelin approved in the Philippines? Tesamorelin: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "Approved for reduction of excess abdominal fat in HIV-infected adult patients with lipodystrophy". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA Approved for reduction of excess abdominal fat in HIV-infected adult patients with lipodystrophy Drugs@FDA: Egrifta (BLA022505, approved 10 November 2010). The approval covers the named branded medicine for its labelled use only, never a research-grade vial of the same substance. [Source](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=022505) · checked 23 September 2026 EMA Not approved The application for Egrifta (EMEA/H/C/002427) was withdrawn on 21 June 2012; no marketing authorisation was granted. [Source](https://www.ema.europa.eu/en/medicines/human/EPAR/egrifta) · checked 23 September 2026 Sponsor's next milestone Not established None sought: an approved medicine already exists. Not published - [Evidence Map: Tesamorelin](https://www.primaralabs.com/research/evidence#tesamorelin) - [Tesamorelin 10mg](https://www.primaralabs.com/marketplace/tesamorelin-10mg) Growth hormone axis ## Is CJC-1295 approved in the Philippines? CJC-1295: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "No record found". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22CJC-1295%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established No sponsor identified in any record read. Not published - [Evidence Map: CJC-1295](https://www.primaralabs.com/research/evidence#cjc-1295) - [CJC-1295 / Ipamorelin 5mg + 5mg](https://www.primaralabs.com/marketplace/cjc-1295-ipamorelin-10mg) Growth hormone axis ## Is Ipamorelin approved in the Philippines? Ipamorelin: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "No record found". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22ipamorelin%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established No sponsor identified in any record read. Not published - [Evidence Map: Ipamorelin](https://www.primaralabs.com/research/evidence#ipamorelin) - [CJC-1295 / Ipamorelin 5mg + 5mg](https://www.primaralabs.com/marketplace/cjc-1295-ipamorelin-10mg) Melanocortin ## Is Bremelanotide approved in the Philippines? Bremelanotide: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "Approved for acquired, generalized hypoactive sexual desire disorder (HSDD) in premenopausal women". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA Approved for acquired, generalized hypoactive sexual desire disorder (HSDD) in premenopausal women Drugs@FDA: Vyleesi (NDA210557, approved 21 June 2019). The approval covers the named branded medicine for its labelled use only, never a research-grade vial of the same substance. [Source](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=210557) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established None sought: an approved medicine already exists. Not published - [Evidence Map: Bremelanotide](https://www.primaralabs.com/research/evidence#bremelanotide) - [PT-141 10mg](https://www.primaralabs.com/marketplace/pt-141-10mg) Neuropeptide ## Is Semax approved in the Philippines? Semax: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "No record found". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22semax%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established No sponsor identified in any record read. Not published - [Evidence Map: Semax](https://www.primaralabs.com/research/evidence#semax) - [Semax 10mg](https://www.primaralabs.com/marketplace/semax-10mg) Neuropeptide ## Is Selank approved in the Philippines? Selank: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "No record found". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22selank%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established No sponsor identified in any record read. Not published - [Evidence Map: Selank](https://www.primaralabs.com/research/evidence#selank) - [Selank 10mg](https://www.primaralabs.com/marketplace/selank-10mg) Neuropeptide ## Is DSIP approved in the Philippines? DSIP: FDA Philippines status not established (Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result.); US FDA "No record found". Checked 23 September 2026. FDA Philippines Not established Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. Not published US FDA No record found Drugs@FDA returned no approved or tentatively approved application for this substance. Drugs@FDA does not list investigational products. Separately, the FDA lists it on its page of bulk drug substances for compounding that may present significant safety risks (current as of 22 April 2026); that page concerns compounding, not approval. [Source](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22delta%20sleep-inducing%20peptide%22&limit=10) · checked 23 September 2026 EMA No record found No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. [Source](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 Sponsor's next milestone Not established No sponsor identified in any record read. Not published - [Evidence Map: DSIP](https://www.primaralabs.com/research/evidence#dsip) - [DSIP 10mg](https://www.primaralabs.com/marketplace/dsip-10mg) FDA Philippines ## Advisories naming these compounds | Advisory | Date | Compounds | Summary | | --- | --- | --- | --- | | [FDA Advisory No. 2026-1020](https://www.fda.gov.ph/fda-advisory-no-2026-1020-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-tirzepatide-subcutaneously-use-only-30mg-multi-use-vial-and-bac-water-0-9-benz/) | 2026-09-04 | Tirzepatide | FDA Philippines warned the public against buying or using an unregistered tirzepatide 30mg multi-use vial sold with bacteriostatic water, which had not been issued a Certificate of Product Registration. | | [FDA Advisory No. 2026-1013](https://www.fda.gov.ph/fda-advisory-no-2026-1013-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-kpv-subcutaneous-use-only-10mg-1ml-multi-use-vial-and-bacteriostatic-water-ste/) | 2026-09-04 | KPV | FDA Philippines warned the public against buying or using an unregistered KPV 10mg/1ml multi-use vial sold with bacteriostatic water, which had not been issued a Certificate of Product Registration. | | [FDA Advisory No. 2026-1019](https://www.fda.gov.ph/fda-advisory-no-2026-1019-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-peptatide-tirzepatide-for-subcutaneously-use-only-15mg-and-peptatide-bacterios/) | 2026-09-04 | Tirzepatide | FDA Philippines warned the public against buying or using an unregistered tirzepatide product sold as Peptatide Tirzepatide 15mg with a bacteriostatic water kit, which had not been issued a Certificate of Product Registration. | | [FDA Advisory No. 2026-0814](https://www.fda.gov.ph/fda-advisory-no-2026-0814-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-tirz-laine-tirzepatide-30mg-3-ml-99-purity/) | 2026-07-30 | Tirzepatide | FDA Philippines warned the public against buying or using an unregistered tirzepatide product sold as Tirz Laine Tirzepatide 30mg/3 mL, which had not been issued a Certificate of Product Registration. | | [FDA Advisory No. 2026-0596](https://www.fda.gov.ph/fda-advisory-no-2026-0596-endorsement-of-updates-on-the-list-of-vat-exempt-drugs-and-medicines/) | 2026-05-04 | Tirzepatide | FDA Philippines published updates to its list of VAT-exempt drugs and medicines under the CREATE Act, listing tirzepatide solutions for subcutaneous injection under medicines for diabetes. | | [FDA Advisory No. 2026-0065](https://www.fda.gov.ph/fda-advisory-no-2026-0065-endorsement-of-updates-on-the-list-of-vat-exempt-health-products/) | 2026-02-06 | Tirzepatide | FDA Philippines published updates to its list of VAT-exempt health products under the CREATE Act, listing tirzepatide solutions for subcutaneous injection among drugs for diabetes. | | [FDA Advisory No. 2025-1200](https://www.fda.gov.ph/fda-advisory-no-2025-1200-endorsement-of-updates-on-the-list-of-vat-exempt-health-products/) | 2025-11-06 | Semaglutide | FDA Philippines published updates to its list of VAT-exempt health products under the CREATE Act, including seven semaglutide solutions for injection listed under drugs for diabetes. | | [FDA Advisory No. 2025-0084](https://www.fda.gov.ph/fda-advisory-no-2025-0084-public-health-warning-against-the-purchase-and-consumption-of-the-unregistered-food-supplement-fulimiks-liposomal-nad-dietary-supplement-120-capsules/) | 2025-01-30 | NAD+ | FDA Philippines warned the public against buying or consuming an unregistered liposomal NAD+ food supplement in capsules, for which no Certificate of Product Registration had been issued. | [Download JSON](https://www.primaralabs.com/data/fda-ph-advisories.json)[Download CSV](https://www.primaralabs.com/data/fda-ph-advisories.csv) Method ## How statuses are recorded Methodology Values are exactly one of "Not approved", "Approved for" a named indication, "Investigational" or "No record found". "No record found" means the authority's database was searched and returned nothing; a status that could not be read is shown as "Not established" with the reason. US FDA statuses come from Drugs@FDA and the FDA label; EMA statuses from the EMA medicines data; FDA Philippines from its own registration records and advisories. Cite this Primara Labs Research Desk, "Regulatory status of research peptides", last updated 23 September 2026, https://www.primaralabs.com/research/status --- URL: https://www.primaralabs.com/batch Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/batch.md # Enter the batch printed on your vial. As of 23 September 2026, Primara Labs has published laboratory reports for 1 batch. Each batch page lists every report for that batch, what it covers and does not, and the laboratory's verification key as plain text. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Look up ## Find a batch Batch printed on your vial[Look up](https://www.primaralabs.com/batch) - [RETA-4728-A](https://www.primaralabs.com/batch/reta-4728-a) [Download JSON](https://www.primaralabs.com/data/batch-reports.json)[Download CSV](https://www.primaralabs.com/data/batch-reports.csv) --- URL: https://www.primaralabs.com/research/trials/triumph-1 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/triumph-1.md # TRIUMPH-1 In TRIUMPH-1, a phase 3 trial of retatrutide in adults with obesity, or overweight with at least one weight-related condition, without diabetes (n=2,339), mean body weight fell 19.0% on 4 mg, 25.9% on 9 mg and 28.3% on 12 mg over 80 weeks, against 2.2% on placebo (efficacy estimand; Eli Lilly topline release, 21 May 2026). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported In TRIUMPH-1, discontinuation because of adverse events was 4.1% on 4 mg, 6.9% on 9 mg and 11.3% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were nausea in 28.6% on 4 mg, 38.4% on 9 mg and 42.4% on 12 mg against 14.8% on placebo, diarrhoea in 25.2% on 4 mg, 34.1% on 9 mg and 32.0% on 12 mg against 13.5% on placebo, constipation in 23.8% on 4 mg, 25.9% on 9 mg and 26.1% on 12 mg against 10.9% on placebo and vomiting in 10.6% on 4 mg, 22.8% on 9 mg and 25.3% on 12 mg against 4.8% on placebo. | Event | 4 mg | 9 mg | 12 mg | Placebo | | --- | --- | --- | --- | --- | | Discontinuation for adverse events | 4.1% | 6.9% | 11.3% | 4.9% | | Nausea | 28.6% | 38.4% | 42.4% | 14.8% | | Diarrhoea | 25.2% | 34.1% | 32.0% | 13.5% | | Constipation | 23.8% | 25.9% | 26.1% | 10.9% | | Vomiting | 10.6% | 22.8% | 25.3% | 4.8% | | Dysesthesia | 5.1% | 12.3% | 12.5% | 0.9% | | Urinary tract infection | 7.5% | 8.8% | 8.4% | 5.3% | Design ## Trial design and sources Compound Retatrutide Phase 3 Population Adults with obesity, or overweight with at least one weight-related condition, without diabetes Participants randomised 2,339 Duration 80 weeks Primary endpoint Percent change in body weight from baseline at 80 weeks Estimand efficacy Read out 21 May 2026 A pre-specified extension of 532 participants with a baseline BMI of 35 or more reached -30.3% on 12 mg at 104 weeks (efficacy estimand). The treatment-regimen estimand at 80 weeks was -17.6%, -23.7% and -25.0% against -3.9% on placebo. - Eli Lilly topline release, 21 May 2026 [open](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss) · checked 23 September 2026 - ClinicalTrials.gov NCT05929066 [open](https://clinicaltrials.gov/study/NCT05929066) · checked 23 September 2026 - Registry: NCT05929066 Questions ## TRIUMPH-1, answered ### What did TRIUMPH-1 find? In TRIUMPH-1, a phase 3 trial of retatrutide in adults with obesity, or overweight with at least one weight-related condition, without diabetes (n=2,339), mean body weight fell 19.0% on 4 mg, 25.9% on 9 mg and 28.3% on 12 mg over 80 weeks, against 2.2% on placebo (efficacy estimand; Eli Lilly topline release, 21 May 2026). ### What side effects were reported in TRIUMPH-1? In TRIUMPH-1, discontinuation because of adverse events was 4.1% on 4 mg, 6.9% on 9 mg and 11.3% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were nausea in 28.6% on 4 mg, 38.4% on 9 mg and 42.4% on 12 mg against 14.8% on placebo, diarrhoea in 25.2% on 4 mg, 34.1% on 9 mg and 32.0% on 12 mg against 13.5% on placebo, constipation in 23.8% on 4 mg, 25.9% on 9 mg and 26.1% on 12 mg against 10.9% on placebo and vomiting in 10.6% on 4 mg, 22.8% on 9 mg and 25.3% on 12 mg against 4.8% on placebo. Related ## More on retatrutide - [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) - [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) - [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) - [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) - [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/research/trials/triumph-2 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/triumph-2.md # TRIUMPH-2 In TRIUMPH-2, a phase 3 trial of retatrutide in adults with type 2 diabetes and obesity or overweight (n=1,152), mean body weight fell 12.7% on 4 mg, 19.1% on 9 mg and 20.8% on 12 mg over 80 weeks, against 4.0% on placebo (efficacy estimand; Eli Lilly topline release, 23 July 2026). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. A1C fell 1.4, 1.6 and 1.5 points from a baseline of 7.7% on 4, 9 and 12 mg, against 0.2 on placebo. ## Side effects reported In TRIUMPH-2, discontinuation because of adverse events was 3.8% on 4 mg, 11.6% on 9 mg and 7.7% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were diarrhoea in 27.4% on 4 mg, 33.5% on 9 mg and 33.6% on 12 mg against 13.2% on placebo, nausea in 13.7% on 4 mg, 20.8% on 9 mg and 28.0% on 12 mg against 8.0% on placebo, constipation in 14.0% on 4 mg, 16.2% on 9 mg and 16.8% on 12 mg against 9.4% on placebo and decreased appetite in 5.8% on 4 mg, 12.3% on 9 mg and 17.1% on 12 mg against 4.5% on placebo. | Event | 4 mg | 9 mg | 12 mg | Placebo | | --- | --- | --- | --- | --- | | Discontinuation for adverse events | 3.8% | 11.6% | 7.7% | 4.9% | | Diarrhoea | 27.4% | 33.5% | 33.6% | 13.2% | | Nausea | 13.7% | 20.8% | 28.0% | 8.0% | | Constipation | 14.0% | 16.2% | 16.8% | 9.4% | | Decreased appetite | 5.8% | 12.3% | 17.1% | 4.5% | | Vomiting | 5.5% | 10.2% | 15.7% | 4.2% | | Dysesthesia | 4.5% | 5.6% | 7.3% | 0.7% | | Urinary tract infection | 3.8% | 6.3% | 8.0% | 6.6% | Design ## Trial design and sources Compound Retatrutide Phase 3 Population Adults with type 2 diabetes and obesity or overweight Participants randomised 1,152 Duration 80 weeks Primary endpoint Percent change in body weight from baseline at 80 weeks Estimand efficacy Read out 23 July 2026 - Eli Lilly topline release, 23 July 2026 [open](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 - ClinicalTrials.gov NCT05929079 [open](https://clinicaltrials.gov/study/NCT05929079) · checked 23 September 2026 - Registry: NCT05929079 Questions ## TRIUMPH-2, answered ### What did TRIUMPH-2 find? In TRIUMPH-2, a phase 3 trial of retatrutide in adults with type 2 diabetes and obesity or overweight (n=1,152), mean body weight fell 12.7% on 4 mg, 19.1% on 9 mg and 20.8% on 12 mg over 80 weeks, against 4.0% on placebo (efficacy estimand; Eli Lilly topline release, 23 July 2026). ### What side effects were reported in TRIUMPH-2? In TRIUMPH-2, discontinuation because of adverse events was 3.8% on 4 mg, 11.6% on 9 mg and 7.7% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were diarrhoea in 27.4% on 4 mg, 33.5% on 9 mg and 33.6% on 12 mg against 13.2% on placebo, nausea in 13.7% on 4 mg, 20.8% on 9 mg and 28.0% on 12 mg against 8.0% on placebo, constipation in 14.0% on 4 mg, 16.2% on 9 mg and 16.8% on 12 mg against 9.4% on placebo and decreased appetite in 5.8% on 4 mg, 12.3% on 9 mg and 17.1% on 12 mg against 4.5% on placebo. Related ## More on retatrutide - [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) - [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) - [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) - [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) - [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/research/trials/triumph-3 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/triumph-3.md # TRIUMPH-3 In TRIUMPH-3, a phase 3 trial of retatrutide in adults with severe obesity (BMI of 35 or more) and established cardiovascular disease, with or without type 2 diabetes (n=1,949), mean body weight fell 21.6% on 9 mg and 22.6% on 12 mg over 80 weeks, against 3.2% on placebo (efficacy estimand; Eli Lilly topline release, 23 July 2026). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. In a pre-specified in-study analysis of time to first MACE-5 event, pooled retatrutide against placebo had a hazard ratio of 0.82 (95% CI 0.55 to 1.22). ## Side effects reported In TRIUMPH-3, discontinuation because of adverse events was 9.8% on 9 mg and 13.5% on 12 mg, against 4.8% on placebo. The most frequently reported adverse events were diarrhoea in 30.1% on 9 mg and 24.4% on 12 mg against 8.7% on placebo, nausea in 21.7% on 9 mg and 22.4% on 12 mg against 5.8% on placebo, constipation in 18.0% on 9 mg and 15.7% on 12 mg against 7.1% on placebo and decreased appetite in 13.5% on 9 mg and 14.5% on 12 mg against 3.0% on placebo. | Event | 9 mg | 12 mg | Placebo | | --- | --- | --- | --- | | Discontinuation for adverse events | 9.8% | 13.5% | 4.8% | | Diarrhoea | 30.1% | 24.4% | 8.7% | | Nausea | 21.7% | 22.4% | 5.8% | | Constipation | 18.0% | 15.7% | 7.1% | | Decreased appetite | 13.5% | 14.5% | 3.0% | | Dysesthesia | 6.4% | 6.4% | 1.3% | | Urinary tract infection | 6.1% | 7.0% | 5.3% | Design ## Trial design and sources Compound Retatrutide Phase 3 Population Adults with severe obesity (BMI of 35 or more) and established cardiovascular disease, with or without type 2 diabetes Participants randomised 1,949 Duration 80 weeks Primary endpoint Percent change in body weight from baseline at 80 weeks Estimand efficacy Read out 23 July 2026 - Eli Lilly topline release, 23 July 2026 [open](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 - ClinicalTrials.gov NCT05882045 [open](https://clinicaltrials.gov/study/NCT05882045) · checked 23 September 2026 - Registry: NCT05882045 Questions ## TRIUMPH-3, answered ### What did TRIUMPH-3 find? In TRIUMPH-3, a phase 3 trial of retatrutide in adults with severe obesity (BMI of 35 or more) and established cardiovascular disease, with or without type 2 diabetes (n=1,949), mean body weight fell 21.6% on 9 mg and 22.6% on 12 mg over 80 weeks, against 3.2% on placebo (efficacy estimand; Eli Lilly topline release, 23 July 2026). ### What side effects were reported in TRIUMPH-3? In TRIUMPH-3, discontinuation because of adverse events was 9.8% on 9 mg and 13.5% on 12 mg, against 4.8% on placebo. The most frequently reported adverse events were diarrhoea in 30.1% on 9 mg and 24.4% on 12 mg against 8.7% on placebo, nausea in 21.7% on 9 mg and 22.4% on 12 mg against 5.8% on placebo, constipation in 18.0% on 9 mg and 15.7% on 12 mg against 7.1% on placebo and decreased appetite in 13.5% on 9 mg and 14.5% on 12 mg against 3.0% on placebo. Related ## More on retatrutide - [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) - [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) - [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) - [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) - [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/research/trials/triumph-4 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/triumph-4.md # TRIUMPH-4 In TRIUMPH-4, a phase 3 trial of retatrutide in adults with obesity or overweight and knee osteoarthritis, without diabetes (n=445), mean body weight fell 26.4% on 9 mg and 28.7% on 12 mg over 68 weeks, against 2.1% on placebo (efficacy estimand; Eli Lilly topline release, 11 December 2025). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. WOMAC pain fell 4.5 and 4.4 points from a baseline of 6.0 on 9 and 12 mg, against 2.4 on placebo. ## Side effects reported In TRIUMPH-4, discontinuation because of adverse events was 12.2% on 9 mg and 18.2% on 12 mg, against 4.0% on placebo. The most frequently reported adverse events were nausea in 38.1% on 9 mg and 43.2% on 12 mg against 10.7% on placebo, diarrhoea in 34.7% on 9 mg and 33.1% on 12 mg against 13.4% on placebo, constipation in 21.8% on 9 mg and 25.0% on 12 mg against 8.7% on placebo and vomiting in 20.4% on 9 mg and 20.9% on 12 mg against 0.0% on placebo. | Event | 9 mg | 12 mg | Placebo | | --- | --- | --- | --- | | Discontinuation for adverse events | 12.2% | 18.2% | 4.0% | | Nausea | 38.1% | 43.2% | 10.7% | | Diarrhoea | 34.7% | 33.1% | 13.4% | | Constipation | 21.8% | 25.0% | 8.7% | | Vomiting | 20.4% | 20.9% | 0.0% | | Decreased appetite | 19.0% | 18.2% | 9.4% | | Dysesthesia | 8.8% | 20.9% | 0.7% | Design ## Trial design and sources Compound Retatrutide Phase 3 Population Adults with obesity or overweight and knee osteoarthritis, without diabetes Participants randomised 445 Duration 68 weeks Primary endpoint Co-primary: percent change in body weight and change in WOMAC pain score at 68 weeks Estimand efficacy Read out 11 December 2025 - Eli Lilly topline release, 11 December 2025 [open](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-weight-loss-average) · checked 23 September 2026 - ClinicalTrials.gov NCT05931367 [open](https://clinicaltrials.gov/study/NCT05931367) · checked 23 September 2026 - Registry: NCT05931367 Questions ## TRIUMPH-4, answered ### What did TRIUMPH-4 find? In TRIUMPH-4, a phase 3 trial of retatrutide in adults with obesity or overweight and knee osteoarthritis, without diabetes (n=445), mean body weight fell 26.4% on 9 mg and 28.7% on 12 mg over 68 weeks, against 2.1% on placebo (efficacy estimand; Eli Lilly topline release, 11 December 2025). ### What side effects were reported in TRIUMPH-4? In TRIUMPH-4, discontinuation because of adverse events was 12.2% on 9 mg and 18.2% on 12 mg, against 4.0% on placebo. The most frequently reported adverse events were nausea in 38.1% on 9 mg and 43.2% on 12 mg against 10.7% on placebo, diarrhoea in 34.7% on 9 mg and 33.1% on 12 mg against 13.4% on placebo, constipation in 21.8% on 9 mg and 25.0% on 12 mg against 8.7% on placebo and vomiting in 20.4% on 9 mg and 20.9% on 12 mg against 0.0% on placebo. Related ## More on retatrutide - [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) - [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) - [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) - [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) - [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/research/trials/retatrutide-phase-2 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/retatrutide-phase-2.md # Retatrutide phase 2 (Jastreboff) In Retatrutide phase 2 (Jastreboff), a phase 2 trial of retatrutide in adults with a BMI of 30 or more, or 27 to under 30 with at least one weight-related condition (n=338), mean body weight fell 8.7% on 1 mg, 17.1% on 4 mg (pooled), 22.8% on 8 mg (pooled) and 24.2% on 12 mg over 48 weeks, against 2.1% on placebo (Jastreboff AM et al. N Engl J Med 2023;389:514-526). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported Retatrutide phase 2 (Jastreboff): The abstract reports gastrointestinal events as the most common, dose-related and mostly mild to moderate, without rates; rates by arm are in the full text, not read here. Design ## Trial design and sources Compound Retatrutide Phase 2 Population Adults with a BMI of 30 or more, or 27 to under 30 with at least one weight-related condition Participants randomised 338 Duration 48 weeks Primary endpoint Percent change in body weight from baseline at 24 weeks; 48 weeks secondary Estimand Not stated in the source read Read out 26 June 2023 48-week figures (least-squares mean). At the 24-week primary endpoint the arms were -7.2%, -12.9%, -17.3% and -17.5% against -1.6% on placebo. The abstract reports gastrointestinal events as the most common, dose-related and mostly mild to moderate, without rates; rates by arm are in the full text, not read here. - Jastreboff AM et al. N Engl J Med 2023;389:514-526 [open](https://doi.org/10.1056/NEJMoa2301972) · checked 23 September 2026 - ClinicalTrials.gov NCT04881760 [open](https://clinicaltrials.gov/study/NCT04881760) · checked 23 September 2026 - Registry: NCT04881760 Questions ## Retatrutide phase 2 (Jastreboff), answered ### What did Retatrutide phase 2 (Jastreboff) find? In Retatrutide phase 2 (Jastreboff), a phase 2 trial of retatrutide in adults with a BMI of 30 or more, or 27 to under 30 with at least one weight-related condition (n=338), mean body weight fell 8.7% on 1 mg, 17.1% on 4 mg (pooled), 22.8% on 8 mg (pooled) and 24.2% on 12 mg over 48 weeks, against 2.1% on placebo (Jastreboff AM et al. N Engl J Med 2023;389:514-526). ### What side effects were reported in Retatrutide phase 2 (Jastreboff)? Retatrutide phase 2 (Jastreboff): The abstract reports gastrointestinal events as the most common, dose-related and mostly mild to moderate, without rates; rates by arm are in the full text, not read here. Related ## More on retatrutide - [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) - [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) - [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) - [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) - [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/research/trials/triumph-5 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/triumph-5.md # TRIUMPH-5 TRIUMPH-5 is a phase 3 trial of retatrutide against tirzepatide in adults who have obesity, registered as NCT06662383 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Design ## Trial design and sources Compound Retatrutide Phase 3 Population Adults who have obesity Participants randomised Not published Duration Not published Primary endpoint Compared with tirzepatide Estimand Not stated in the source read Read out Not yet reported - ClinicalTrials.gov record, active, not recruiting [open](https://clinicaltrials.gov/study/NCT06662383) · checked 23 September 2026 - Registry: NCT06662383 Questions ## TRIUMPH-5, answered ### What did TRIUMPH-5 find? TRIUMPH-5 is a phase 3 trial of retatrutide against tirzepatide in adults who have obesity, registered as NCT06662383 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). ### When will TRIUMPH-5 report? TRIUMPH-5 is active and not recruiting on ClinicalTrials.gov (NCT06662383); no results have been published. Checked 23 September 2026. Related ## More on retatrutide - [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) - [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) - [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) - [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) - [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/research/trials/triumph-6 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/triumph-6.md # TRIUMPH-6 TRIUMPH-6 is a phase 3 trial of retatrutide in adults with obesity (maintenance of weight reduction), registered as NCT06859268 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Design ## Trial design and sources Compound Retatrutide Phase 3 Population Adults with obesity Participants randomised Not published Duration Not published Primary endpoint Maintenance of weight reduction Estimand Not stated in the source read Read out Not yet reported - ClinicalTrials.gov record, active, not recruiting [open](https://clinicaltrials.gov/study/NCT06859268) · checked 23 September 2026 - Registry: NCT06859268 Questions ## TRIUMPH-6, answered ### What did TRIUMPH-6 find? TRIUMPH-6 is a phase 3 trial of retatrutide in adults with obesity (maintenance of weight reduction), registered as NCT06859268 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). ### When will TRIUMPH-6 report? TRIUMPH-6 is active and not recruiting on ClinicalTrials.gov (NCT06859268); no results have been published. Checked 23 September 2026. Related ## More on retatrutide - [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) - [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) - [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) - [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/research/trials/triumph-7 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/triumph-7.md # TRIUMPH-7 TRIUMPH-7 is a phase 3 trial of retatrutide in adults with obesity or overweight and chronic low back pain, registered as NCT07035093 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Design ## Trial design and sources Compound Retatrutide Phase 3 Population Adults with obesity or overweight and chronic low back pain Participants randomised Not published Duration Not published Primary endpoint Not published Estimand Not stated in the source read Read out Not yet reported - ClinicalTrials.gov record, active, not recruiting [open](https://clinicaltrials.gov/study/NCT07035093) · checked 23 September 2026 - Registry: NCT07035093 Questions ## TRIUMPH-7, answered ### What did TRIUMPH-7 find? TRIUMPH-7 is a phase 3 trial of retatrutide in adults with obesity or overweight and chronic low back pain, registered as NCT07035093 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). ### When will TRIUMPH-7 report? TRIUMPH-7 is active and not recruiting on ClinicalTrials.gov (NCT07035093); no results have been published. Checked 23 September 2026. Related ## More on retatrutide - [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) - [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) - [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) - [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/research/trials/triumph-8 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/triumph-8.md # TRIUMPH-8 TRIUMPH-8 is a phase 3 trial of retatrutide in adults with obesity or overweight, registered as NCT07232719 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Design ## Trial design and sources Compound Retatrutide Phase 3 Population Adults with obesity or overweight Participants randomised Not published Duration Not published Primary endpoint Not published Estimand Not stated in the source read Read out Not yet reported - ClinicalTrials.gov record, active, not recruiting [open](https://clinicaltrials.gov/study/NCT07232719) · checked 23 September 2026 - Registry: NCT07232719 Questions ## TRIUMPH-8, answered ### What did TRIUMPH-8 find? TRIUMPH-8 is a phase 3 trial of retatrutide in adults with obesity or overweight, registered as NCT07232719 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). ### When will TRIUMPH-8 report? TRIUMPH-8 is active and not recruiting on ClinicalTrials.gov (NCT07232719); no results have been published. Checked 23 September 2026. Related ## More on retatrutide - [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) - [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) - [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) - [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/research/trials/triumph-9 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/triumph-9.md # TRIUMPH-9 TRIUMPH-9 is a phase 3 trial of retatrutide in adults without type 2 diabetes who have obesity or overweight, registered as NCT07357415 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Design ## Trial design and sources Compound Retatrutide Phase 3 Population Adults without type 2 diabetes who have obesity or overweight Participants randomised Not published Duration Not published Primary endpoint Not published Estimand Not stated in the source read Read out Not yet reported - ClinicalTrials.gov record, active, not recruiting [open](https://clinicaltrials.gov/study/NCT07357415) · checked 23 September 2026 - Registry: NCT07357415 Questions ## TRIUMPH-9, answered ### What did TRIUMPH-9 find? TRIUMPH-9 is a phase 3 trial of retatrutide in adults without type 2 diabetes who have obesity or overweight, registered as NCT07357415 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). ### When will TRIUMPH-9 report? TRIUMPH-9 is active and not recruiting on ClinicalTrials.gov (NCT07357415); no results have been published. Checked 23 September 2026. Related ## More on retatrutide - [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) - [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) - [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) - [TRIUMPH-OUTCOMES](https://www.primaralabs.com/research/trials/triumph-outcomes) - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/research/trials/triumph-outcomes Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/triumph-outcomes.md # TRIUMPH-OUTCOMES TRIUMPH-OUTCOMES is a phase 3 trial of retatrutide in adults living with obesity (cardiovascular and kidney outcomes), registered as NCT06383390 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Design ## Trial design and sources Compound Retatrutide Phase 3 Population Adults living with obesity Participants randomised Not published Duration Not published Primary endpoint Cardiovascular and kidney outcomes Estimand Not stated in the source read Read out Not yet reported - ClinicalTrials.gov record, active, not recruiting [open](https://clinicaltrials.gov/study/NCT06383390) · checked 23 September 2026 - Registry: NCT06383390 Questions ## TRIUMPH-OUTCOMES, answered ### What did TRIUMPH-OUTCOMES find? TRIUMPH-OUTCOMES is a phase 3 trial of retatrutide in adults living with obesity (cardiovascular and kidney outcomes), registered as NCT06383390 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). ### When will TRIUMPH-OUTCOMES report? TRIUMPH-OUTCOMES is active and not recruiting on ClinicalTrials.gov (NCT06383390); no results have been published. Checked 23 September 2026. Related ## More on retatrutide - [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) - [TRIUMPH-2](https://www.primaralabs.com/research/trials/triumph-2) - [TRIUMPH-3](https://www.primaralabs.com/research/trials/triumph-3) - [TRIUMPH-4](https://www.primaralabs.com/research/trials/triumph-4) - [Retatrutide phase 2 (Jastreboff)](https://www.primaralabs.com/research/trials/retatrutide-phase-2) - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [TRIUMPH-6](https://www.primaralabs.com/research/trials/triumph-6) - [TRIUMPH-7](https://www.primaralabs.com/research/trials/triumph-7) - [TRIUMPH-8](https://www.primaralabs.com/research/trials/triumph-8) - [TRIUMPH-9](https://www.primaralabs.com/research/trials/triumph-9) - [Evidence Map: Retatrutide](https://www.primaralabs.com/research/evidence#retatrutide) - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/research/trials/step-1 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/step-1.md # STEP 1 In STEP 1, a phase 3 trial of semaglutide in adults with BMI of 30 or greater (27 or greater with at least one weight-related coexisting condition), without diabetes (n=1,961), mean body weight fell 14.9% on 2.4 mg over 68 weeks, against 2.4% on placebo (treatment-policy estimand; Wilding JPH et al. N Engl J Med 2021;384:989-1002). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported STEP 1: Discontinuation for adverse events is not given in the abstract; discontinuation for gastrointestinal adverse events was 4.5% against 0.8% on placebo. Design ## Trial design and sources Compound Semaglutide Phase 3 Population Adults with BMI of 30 or greater (27 or greater with at least one weight-related coexisting condition), without diabetes Participants randomised 1,961 Duration 68 weeks Primary endpoint Coprimary: percentage change in body weight and weight reduction of at least 5% (week 68) Estimand treatment-policy Read out 10 February 2021 Discontinuation for adverse events is not given in the abstract; discontinuation for gastrointestinal adverse events was 4.5% against 0.8% on placebo. The estimand is described in the abstract (effects regardless of treatment discontinuation or rescue) without being named. - Wilding JPH et al. N Engl J Med 2021;384:989-1002 [open](https://doi.org/10.1056/NEJMoa2032183) · checked 23 September 2026 - ClinicalTrials.gov NCT03548935 [open](https://clinicaltrials.gov/study/NCT03548935) · checked 23 September 2026 - Registry: NCT03548935 Questions ## STEP 1, answered ### What did STEP 1 find? In STEP 1, a phase 3 trial of semaglutide in adults with BMI of 30 or greater (27 or greater with at least one weight-related coexisting condition), without diabetes (n=1,961), mean body weight fell 14.9% on 2.4 mg over 68 weeks, against 2.4% on placebo (treatment-policy estimand; Wilding JPH et al. N Engl J Med 2021;384:989-1002). ### What side effects were reported in STEP 1? STEP 1: Discontinuation for adverse events is not given in the abstract; discontinuation for gastrointestinal adverse events was 4.5% against 0.8% on placebo. Related ## More on semaglutide - [STEP 2](https://www.primaralabs.com/research/trials/step-2) - [STEP 3](https://www.primaralabs.com/research/trials/step-3) - [STEP 4](https://www.primaralabs.com/research/trials/step-4) - [STEP 5](https://www.primaralabs.com/research/trials/step-5) - [STEP 8](https://www.primaralabs.com/research/trials/step-8) - [SELECT](https://www.primaralabs.com/research/trials/select) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Evidence Map: Semaglutide](https://www.primaralabs.com/research/evidence#semaglutide) - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) --- URL: https://www.primaralabs.com/research/trials/step-2 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/step-2.md # STEP 2 In STEP 2, a phase 3 trial of semaglutide in adults with BMI of at least 27 kg/m2 and HbA1c 7-10% (53-86 mmol/mol), diagnosed with type 2 diabetes at least 180 days before screening (n=1,210), mean body weight fell 9.6% on 2.4 mg over 68 weeks, against 3.4% on placebo (Davies M et al. Lancet 2021 (STEP 2)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported The most frequently reported adverse events were gastrointestinal adverse events in 63.5% on 2.4 mg and 57.5% on 1.0 mg against 34.3% on placebo. | Event | 2.4 mg | 1.0 mg | Placebo | | --- | --- | --- | --- | | Gastrointestinal adverse events | 63.5% | 57.5% | 34.3% | Design ## Trial design and sources Compound Semaglutide Phase 3 Population Adults with BMI of at least 27 kg/m2 and HbA1c 7-10% (53-86 mmol/mol), diagnosed with type 2 diabetes at least 180 days before screening Participants randomised 1,210 Duration 68 weeks Primary endpoint Coprimary: percentage change in bodyweight and achievement of weight reduction of at least 5% at 68 weeks, semaglutide 2.4 mg versus placebo Estimand Not stated in the source read Read out 2 March 2021 The abstract gives no body-weight figure for the 1.0 mg arm and does not name the estimand (intention to treat). - Davies M et al. Lancet 2021 (STEP 2) [open](https://doi.org/10.1016/s0140-6736(21)00213-0) · checked 23 September 2026 - ClinicalTrials.gov NCT03552757 [open](https://clinicaltrials.gov/study/NCT03552757) · checked 23 September 2026 - Registry: NCT03552757 Questions ## STEP 2, answered ### What did STEP 2 find? In STEP 2, a phase 3 trial of semaglutide in adults with BMI of at least 27 kg/m2 and HbA1c 7-10% (53-86 mmol/mol), diagnosed with type 2 diabetes at least 180 days before screening (n=1,210), mean body weight fell 9.6% on 2.4 mg over 68 weeks, against 3.4% on placebo (Davies M et al. Lancet 2021 (STEP 2)). ### What side effects were reported in STEP 2? The most frequently reported adverse events were gastrointestinal adverse events in 63.5% on 2.4 mg and 57.5% on 1.0 mg against 34.3% on placebo. Related ## More on semaglutide - [STEP 1](https://www.primaralabs.com/research/trials/step-1) - [STEP 3](https://www.primaralabs.com/research/trials/step-3) - [STEP 4](https://www.primaralabs.com/research/trials/step-4) - [STEP 5](https://www.primaralabs.com/research/trials/step-5) - [STEP 8](https://www.primaralabs.com/research/trials/step-8) - [SELECT](https://www.primaralabs.com/research/trials/select) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Evidence Map: Semaglutide](https://www.primaralabs.com/research/evidence#semaglutide) - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) --- URL: https://www.primaralabs.com/research/trials/step-3 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/step-3.md # STEP 3 In STEP 3, a phase 3 trial of semaglutide in US adults without diabetes with overweight (BMI 27 or greater) plus at least 1 comorbidity or obesity (BMI 30 or greater) (n=611), mean body weight fell 16.0% on 2.4 mg over 68 weeks, against 5.7% on placebo (treatment-policy estimand; Wadden TA et al. JAMA 2021 (STEP 3)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported In STEP 3, discontinuation because of adverse events was 5.9% on 2.4 mg, against 2.9% on placebo. The most frequently reported adverse events were gastrointestinal adverse events in 82.8% on 2.4 mg against 63.2% on placebo, nausea in 58.2% on 2.4 mg against 22.1% on placebo, constipation in 36.9% on 2.4 mg against 24.5% on placebo and diarrhoea in 36.1% on 2.4 mg against 22.1% on placebo. | Event | 2.4 mg | Placebo | | --- | --- | --- | | Discontinuation for adverse events | 5.9% | 2.9% | | Gastrointestinal adverse events | 82.8% | 63.2% | | Nausea | 58.2% | 22.1% | | Constipation | 36.9% | 24.5% | | Diarrhoea | 36.1% | 22.1% | | Vomiting | 27.3% | 10.8% | Design ## Trial design and sources Compound Semaglutide Phase 3 Population US adults without diabetes with overweight (BMI 27 or greater) plus at least 1 comorbidity or obesity (BMI 30 or greater) Participants randomised 611 Duration 68 weeks Primary endpoint Co-primary: percentage change in body weight and loss of 5% or more of baseline weight by week 68 Estimand treatment-policy Read out 1 April 2021 Discontinuation for adverse events is 5.9% against 2.9% in the safety section; the disposition paragraph gives 6.4% against 2.9%. - Wadden TA et al. JAMA 2021 (STEP 3) [open](https://doi.org/10.1001/jama.2021.1831) · checked 23 September 2026 - ClinicalTrials.gov NCT03611582 [open](https://clinicaltrials.gov/study/NCT03611582) · checked 23 September 2026 - Registry: NCT03611582 Questions ## STEP 3, answered ### What did STEP 3 find? In STEP 3, a phase 3 trial of semaglutide in US adults without diabetes with overweight (BMI 27 or greater) plus at least 1 comorbidity or obesity (BMI 30 or greater) (n=611), mean body weight fell 16.0% on 2.4 mg over 68 weeks, against 5.7% on placebo (treatment-policy estimand; Wadden TA et al. JAMA 2021 (STEP 3)). ### What side effects were reported in STEP 3? In STEP 3, discontinuation because of adverse events was 5.9% on 2.4 mg, against 2.9% on placebo. The most frequently reported adverse events were gastrointestinal adverse events in 82.8% on 2.4 mg against 63.2% on placebo, nausea in 58.2% on 2.4 mg against 22.1% on placebo, constipation in 36.9% on 2.4 mg against 24.5% on placebo and diarrhoea in 36.1% on 2.4 mg against 22.1% on placebo. Related ## More on semaglutide - [STEP 1](https://www.primaralabs.com/research/trials/step-1) - [STEP 2](https://www.primaralabs.com/research/trials/step-2) - [STEP 4](https://www.primaralabs.com/research/trials/step-4) - [STEP 5](https://www.primaralabs.com/research/trials/step-5) - [STEP 8](https://www.primaralabs.com/research/trials/step-8) - [SELECT](https://www.primaralabs.com/research/trials/select) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Evidence Map: Semaglutide](https://www.primaralabs.com/research/evidence#semaglutide) - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) --- URL: https://www.primaralabs.com/research/trials/step-4 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/step-4.md # STEP 4 In STEP 4, a phase 3 trial of semaglutide in adults with BMI of at least 30 (or 27 or greater with at least 1 weight-related comorbidity) without diabetes, who reached the 2.4 mg maintenance dose during a 20-week run-in (n=803), mean body weight changed by -7.9% on continued 2.4 mg, weeks 20 to 68 over 68 weeks, against +6.9% on switched to placebo (treatment-policy estimand; Rubino D et al. JAMA 2021 (STEP 4)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported In STEP 4, discontinuation because of adverse events was 2.4% on continued 2.4 mg, weeks 20 to 68, against 2.2% on switched to placebo. The most frequently reported adverse events were gastrointestinal adverse events in 41.9% on continued 2.4 mg, weeks 20 to 68 against 26.1% on switched to placebo, diarrhoea in 14.4% on continued 2.4 mg, weeks 20 to 68 against 7.1% on switched to placebo, nausea in 14.0% on continued 2.4 mg, weeks 20 to 68 against 4.9% on switched to placebo and constipation in 11.6% on continued 2.4 mg, weeks 20 to 68 against 6.3% on switched to placebo. | Event | Continued 2.4 mg, weeks 20 to 68 | Switched to placebo | | --- | --- | --- | | Discontinuation for adverse events | 2.4% | 2.2% | | Gastrointestinal adverse events | 41.9% | 26.1% | | Diarrhoea | 14.4% | 7.1% | | Nausea | 14.0% | 4.9% | | Constipation | 11.6% | 6.3% | | Vomiting | 10.3% | 3.0% | Design ## Trial design and sources Compound Semaglutide Phase 3 Population Adults with BMI of at least 30 (or 27 or greater with at least 1 weight-related comorbidity) without diabetes, who reached the 2.4 mg maintenance dose during a 20-week run-in Participants randomised 803 Duration 68 weeks Primary endpoint Percent change in body weight from week 20 to week 68 Estimand treatment-policy Read out 1 April 2021 Withdrawal design: all participants took semaglutide for a 20-week run-in, then were randomised to continue or switch to placebo. The switch-to-placebo arm regained weight. The abstract gives gastrointestinal events as 49.1%; the results text and Table 3 give 41.9%. - Rubino D et al. JAMA 2021 (STEP 4) [open](https://doi.org/10.1001/jama.2021.3224) · checked 23 September 2026 - ClinicalTrials.gov NCT03548987 [open](https://clinicaltrials.gov/study/NCT03548987) · checked 23 September 2026 - Registry: NCT03548987 Questions ## STEP 4, answered ### What did STEP 4 find? In STEP 4, a phase 3 trial of semaglutide in adults with BMI of at least 30 (or 27 or greater with at least 1 weight-related comorbidity) without diabetes, who reached the 2.4 mg maintenance dose during a 20-week run-in (n=803), mean body weight changed by -7.9% on continued 2.4 mg, weeks 20 to 68 over 68 weeks, against +6.9% on switched to placebo (treatment-policy estimand; Rubino D et al. JAMA 2021 (STEP 4)). ### What side effects were reported in STEP 4? In STEP 4, discontinuation because of adverse events was 2.4% on continued 2.4 mg, weeks 20 to 68, against 2.2% on switched to placebo. The most frequently reported adverse events were gastrointestinal adverse events in 41.9% on continued 2.4 mg, weeks 20 to 68 against 26.1% on switched to placebo, diarrhoea in 14.4% on continued 2.4 mg, weeks 20 to 68 against 7.1% on switched to placebo, nausea in 14.0% on continued 2.4 mg, weeks 20 to 68 against 4.9% on switched to placebo and constipation in 11.6% on continued 2.4 mg, weeks 20 to 68 against 6.3% on switched to placebo. Related ## More on semaglutide - [STEP 1](https://www.primaralabs.com/research/trials/step-1) - [STEP 2](https://www.primaralabs.com/research/trials/step-2) - [STEP 3](https://www.primaralabs.com/research/trials/step-3) - [STEP 5](https://www.primaralabs.com/research/trials/step-5) - [STEP 8](https://www.primaralabs.com/research/trials/step-8) - [SELECT](https://www.primaralabs.com/research/trials/select) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Evidence Map: Semaglutide](https://www.primaralabs.com/research/evidence#semaglutide) - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) --- URL: https://www.primaralabs.com/research/trials/step-5 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/step-5.md # STEP 5 In STEP 5, a phase 3 trial of semaglutide in adults with obesity, or overweight with at least one weight-related comorbidity, without diabetes (n=304), mean body weight fell 15.2% on 2.4 mg over 104 weeks, against 2.6% on placebo (treatment-policy estimand; Garvey WT et al. Nat Med 2022 (STEP 5)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported In STEP 5, discontinuation because of adverse events was 5.9% on 2.4 mg, against 4.6% on placebo. The most frequently reported adverse events were gastrointestinal adverse events in 82.2% on 2.4 mg against 53.9% on placebo, nausea in 53.3% on 2.4 mg against 21.7% on placebo, diarrhoea in 34.9% on 2.4 mg against 23.7% on placebo and constipation in 30.9% on 2.4 mg against 11.2% on placebo. | Event | 2.4 mg | Placebo | | --- | --- | --- | | Discontinuation for adverse events | 5.9% | 4.6% | | Gastrointestinal adverse events | 82.2% | 53.9% | | Nausea | 53.3% | 21.7% | | Diarrhoea | 34.9% | 23.7% | | Constipation | 30.9% | 11.2% | | Vomiting | 30.3% | 4.6% | Design ## Trial design and sources Compound Semaglutide Phase 3 Population Adults with obesity, or overweight with at least one weight-related comorbidity, without diabetes Participants randomised 304 Duration 104 weeks Primary endpoint Co-primary: percentage change in body weight and achievement of weight loss of 5% or more at week 104 Estimand treatment-policy Read out 10 October 2022 - Garvey WT et al. Nat Med 2022 (STEP 5) [open](https://doi.org/10.1038/s41591-022-02026-4) · checked 23 September 2026 - ClinicalTrials.gov NCT03693430 [open](https://clinicaltrials.gov/study/NCT03693430) · checked 23 September 2026 - Registry: NCT03693430 Questions ## STEP 5, answered ### What did STEP 5 find? In STEP 5, a phase 3 trial of semaglutide in adults with obesity, or overweight with at least one weight-related comorbidity, without diabetes (n=304), mean body weight fell 15.2% on 2.4 mg over 104 weeks, against 2.6% on placebo (treatment-policy estimand; Garvey WT et al. Nat Med 2022 (STEP 5)). ### What side effects were reported in STEP 5? In STEP 5, discontinuation because of adverse events was 5.9% on 2.4 mg, against 4.6% on placebo. The most frequently reported adverse events were gastrointestinal adverse events in 82.2% on 2.4 mg against 53.9% on placebo, nausea in 53.3% on 2.4 mg against 21.7% on placebo, diarrhoea in 34.9% on 2.4 mg against 23.7% on placebo and constipation in 30.9% on 2.4 mg against 11.2% on placebo. Related ## More on semaglutide - [STEP 1](https://www.primaralabs.com/research/trials/step-1) - [STEP 2](https://www.primaralabs.com/research/trials/step-2) - [STEP 3](https://www.primaralabs.com/research/trials/step-3) - [STEP 4](https://www.primaralabs.com/research/trials/step-4) - [STEP 8](https://www.primaralabs.com/research/trials/step-8) - [SELECT](https://www.primaralabs.com/research/trials/select) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Evidence Map: Semaglutide](https://www.primaralabs.com/research/evidence#semaglutide) - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) --- URL: https://www.primaralabs.com/research/trials/step-8 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/step-8.md # STEP 8 In STEP 8, a phase 3b trial of semaglutide in US adults with BMI of 30 or greater, or 27 or greater with 1 or more weight-related comorbidities, without diabetes (n=338), mean body weight fell 15.8% on semaglutide 2.4 mg and 6.4% on liraglutide 3.0 mg over 68 weeks, against 1.9% on placebo (pooled) (treatment-policy estimand; Rubino DM et al. JAMA 2022 (STEP 8)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported In STEP 8, discontinuation because of adverse events was 3.2% on semaglutide 2.4 mg and 12.6% on liraglutide 3.0 mg, against 3.5% on placebo (pooled). The most frequently reported adverse events were gastrointestinal disorders in 84.1% on semaglutide 2.4 mg and 82.7% on liraglutide 3.0 mg against 55.3% on placebo (pooled), nausea in 61.1% on semaglutide 2.4 mg and 59.1% on liraglutide 3.0 mg against 22.4% on placebo (pooled), constipation in 38.9% on semaglutide 2.4 mg and 31.5% on liraglutide 3.0 mg against 23.5% on placebo (pooled) and diarrhoea in 27.8% on semaglutide 2.4 mg and 18.1% on liraglutide 3.0 mg against 25.9% on placebo (pooled). | Event | Semaglutide 2.4 mg | Liraglutide 3.0 mg | Placebo (pooled) | | --- | --- | --- | --- | | Discontinuation for adverse events | 3.2% | 12.6% | 3.5% | | Gastrointestinal disorders | 84.1% | 82.7% | 55.3% | | Nausea | 61.1% | 59.1% | 22.4% | | Constipation | 38.9% | 31.5% | 23.5% | | Diarrhoea | 27.8% | 18.1% | 25.9% | | Vomiting | 25.4% | 20.5% | 5.9% | Design ## Trial design and sources Compound Semaglutide Phase 3b Population US adults with BMI of 30 or greater, or 27 or greater with 1 or more weight-related comorbidities, without diabetes Participants randomised 338 Duration 68 weeks Primary endpoint Percentage change in body weight, semaglutide vs liraglutide at week 68 Estimand treatment-policy Read out 1 January 2022 Semaglutide against liraglutide was open-label; each was blinded against its own placebo, pooled. - Rubino DM et al. JAMA 2022 (STEP 8) [open](https://doi.org/10.1001/jama.2021.23619) · checked 23 September 2026 - ClinicalTrials.gov NCT04074161 [open](https://clinicaltrials.gov/study/NCT04074161) · checked 23 September 2026 - Registry: NCT04074161 Questions ## STEP 8, answered ### What did STEP 8 find? In STEP 8, a phase 3b trial of semaglutide in US adults with BMI of 30 or greater, or 27 or greater with 1 or more weight-related comorbidities, without diabetes (n=338), mean body weight fell 15.8% on semaglutide 2.4 mg and 6.4% on liraglutide 3.0 mg over 68 weeks, against 1.9% on placebo (pooled) (treatment-policy estimand; Rubino DM et al. JAMA 2022 (STEP 8)). ### What side effects were reported in STEP 8? In STEP 8, discontinuation because of adverse events was 3.2% on semaglutide 2.4 mg and 12.6% on liraglutide 3.0 mg, against 3.5% on placebo (pooled). The most frequently reported adverse events were gastrointestinal disorders in 84.1% on semaglutide 2.4 mg and 82.7% on liraglutide 3.0 mg against 55.3% on placebo (pooled), nausea in 61.1% on semaglutide 2.4 mg and 59.1% on liraglutide 3.0 mg against 22.4% on placebo (pooled), constipation in 38.9% on semaglutide 2.4 mg and 31.5% on liraglutide 3.0 mg against 23.5% on placebo (pooled) and diarrhoea in 27.8% on semaglutide 2.4 mg and 18.1% on liraglutide 3.0 mg against 25.9% on placebo (pooled). Related ## More on semaglutide - [STEP 1](https://www.primaralabs.com/research/trials/step-1) - [STEP 2](https://www.primaralabs.com/research/trials/step-2) - [STEP 3](https://www.primaralabs.com/research/trials/step-3) - [STEP 4](https://www.primaralabs.com/research/trials/step-4) - [STEP 5](https://www.primaralabs.com/research/trials/step-5) - [SELECT](https://www.primaralabs.com/research/trials/select) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Evidence Map: Semaglutide](https://www.primaralabs.com/research/evidence#semaglutide) - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) --- URL: https://www.primaralabs.com/research/trials/select Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/select.md # SELECT In SELECT, a phase 3 trial of semaglutide in patients 45 years or older with preexisting cardiovascular disease and BMI of 27 or greater, no history of diabetes (n=17,604), the primary endpoint, death from cardiovascular causes, nonfatal myocardial infarction or nonfatal stroke, occurred in 6.5% on semaglutide against 8.0% on placebo, a hazard ratio of 0.80 (95% CI 0.72 to 0.90) (Lincoff AM et al. N Engl J Med 2023 (SELECT)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results The primary endpoint, death from cardiovascular causes, nonfatal myocardial infarction or nonfatal stroke, occurred in 6.5% on semaglutide against 8.0% on placebo, a hazard ratio of 0.80 (95% CI 0.72 to 0.90). ## Side effects reported In SELECT, discontinuation because of adverse events was 16.6% on semaglutide 2.4 mg, against 8.2% on placebo. | Event | Semaglutide 2.4 mg | Placebo | | --- | --- | --- | | Discontinuation for adverse events | 16.6% | 8.2% | Design ## Trial design and sources Compound Semaglutide Phase 3 Population Patients 45 years or older with preexisting cardiovascular disease and BMI of 27 or greater, no history of diabetes Participants randomised 17,604 Duration Not published Primary endpoint Composite of death from cardiovascular causes, nonfatal myocardial infarction, or nonfatal stroke (time to first event) Estimand Not stated in the source read Read out 11 November 2023 Event-driven cardiovascular outcomes trial; mean follow-up 39.8 months. The abstract states no body-weight figure. - Lincoff AM et al. N Engl J Med 2023 (SELECT) [open](https://doi.org/10.1056/NEJMoa2307563) · checked 23 September 2026 - ClinicalTrials.gov NCT03574597 [open](https://clinicaltrials.gov/study/NCT03574597) · checked 23 September 2026 - Registry: NCT03574597 Questions ## SELECT, answered ### What did SELECT find? In SELECT, a phase 3 trial of semaglutide in patients 45 years or older with preexisting cardiovascular disease and BMI of 27 or greater, no history of diabetes (n=17,604), the primary endpoint, death from cardiovascular causes, nonfatal myocardial infarction or nonfatal stroke, occurred in 6.5% on semaglutide against 8.0% on placebo, a hazard ratio of 0.80 (95% CI 0.72 to 0.90) (Lincoff AM et al. N Engl J Med 2023 (SELECT)). ### What side effects were reported in SELECT? In SELECT, discontinuation because of adverse events was 16.6% on semaglutide 2.4 mg, against 8.2% on placebo. Related ## More on semaglutide - [STEP 1](https://www.primaralabs.com/research/trials/step-1) - [STEP 2](https://www.primaralabs.com/research/trials/step-2) - [STEP 3](https://www.primaralabs.com/research/trials/step-3) - [STEP 4](https://www.primaralabs.com/research/trials/step-4) - [STEP 5](https://www.primaralabs.com/research/trials/step-5) - [STEP 8](https://www.primaralabs.com/research/trials/step-8) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Evidence Map: Semaglutide](https://www.primaralabs.com/research/evidence#semaglutide) - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) --- URL: https://www.primaralabs.com/research/trials/surmount-1 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/surmount-1.md # SURMOUNT-1 In SURMOUNT-1, a phase 3 trial of tirzepatide in adults with BMI of 30 or more, or 27 or more with at least one weight-related complication, excluding diabetes (n=2,539), mean body weight fell 15.0% on 5 mg, 19.5% on 10 mg and 20.9% on 15 mg over 72 weeks, against 3.1% on placebo (treatment-regimen estimand; Jastreboff AM et al. N Engl J Med 2022;387:205-216). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported In SURMOUNT-1, discontinuation because of adverse events was 4.3% on 5 mg, 7.1% on 10 mg and 6.2% on 15 mg, against 2.6% on placebo. | Event | 5 mg | 10 mg | 15 mg | Placebo | | --- | --- | --- | --- | --- | | Discontinuation for adverse events | 4.3% | 7.1% | 6.2% | 2.6% | Design ## Trial design and sources Compound Tirzepatide Phase 3 Population Adults with BMI of 30 or more, or 27 or more with at least one weight-related complication, excluding diabetes Participants randomised 2,539 Duration 72 weeks Primary endpoint Coprimary: percentage change in weight from baseline and weight reduction of 5% or more (week 72) Estimand treatment-regimen Read out 4 June 2022 Treatment-regimen estimand, as the NEJM abstract reports it. Lilly's release (28 April 2022) gave 22.5% on 15 mg under the efficacy estimand; that figure is in lib/trials/tirzepatide.ts for like-for-like comparison with the TRIUMPH releases. - Jastreboff AM et al. N Engl J Med 2022;387:205-216 [open](https://doi.org/10.1056/NEJMoa2206038) · checked 23 September 2026 - ClinicalTrials.gov NCT04184622 [open](https://clinicaltrials.gov/study/NCT04184622) · checked 23 September 2026 - Registry: NCT04184622 Questions ## SURMOUNT-1, answered ### What did SURMOUNT-1 find? In SURMOUNT-1, a phase 3 trial of tirzepatide in adults with BMI of 30 or more, or 27 or more with at least one weight-related complication, excluding diabetes (n=2,539), mean body weight fell 15.0% on 5 mg, 19.5% on 10 mg and 20.9% on 15 mg over 72 weeks, against 3.1% on placebo (treatment-regimen estimand; Jastreboff AM et al. N Engl J Med 2022;387:205-216). ### What side effects were reported in SURMOUNT-1? In SURMOUNT-1, discontinuation because of adverse events was 4.3% on 5 mg, 7.1% on 10 mg and 6.2% on 15 mg, against 2.6% on placebo. Related ## More on tirzepatide - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [SURMOUNT-2](https://www.primaralabs.com/research/trials/surmount-2) - [SURMOUNT-3](https://www.primaralabs.com/research/trials/surmount-3) - [SURMOUNT-4](https://www.primaralabs.com/research/trials/surmount-4) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Evidence Map: Tirzepatide](https://www.primaralabs.com/research/evidence#tirzepatide) - [Tirzepatide 15mg](https://www.primaralabs.com/marketplace/tirzepatide-15mg) --- URL: https://www.primaralabs.com/research/trials/surmount-2 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/surmount-2.md # SURMOUNT-2 In SURMOUNT-2, a phase 3 trial of tirzepatide in adults (18 or older) with BMI of 27 kg/m2 or higher and type 2 diabetes with HbA1c 7-10% (53-86 mmol/mol), in seven countries (n=938), mean body weight fell 12.8% on 10 mg and 14.7% on 15 mg over 72 weeks, against 3.2% on placebo (treatment-regimen estimand; Garvey WT et al. Lancet 2023 (SURMOUNT-2)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported SURMOUNT-2: The abstract reports that few adverse events led to discontinuation (under 5%) without per-arm figures. Design ## Trial design and sources Compound Tirzepatide Phase 3 Population Adults (18 or older) with BMI of 27 kg/m2 or higher and type 2 diabetes with HbA1c 7-10% (53-86 mmol/mol), in seven countries Participants randomised 938 Duration 72 weeks Primary endpoint Coprimary: percent change in bodyweight from baseline and bodyweight reduction of 5% or higher (week 72) Estimand treatment-regimen Read out 26 June 2023 The abstract reports that few adverse events led to discontinuation (under 5%) without per-arm figures. - Garvey WT et al. Lancet 2023 (SURMOUNT-2) [open](https://doi.org/10.1016/s0140-6736(23)01200-x) · checked 23 September 2026 - ClinicalTrials.gov NCT04657003 [open](https://clinicaltrials.gov/study/NCT04657003) · checked 23 September 2026 - Registry: NCT04657003 Questions ## SURMOUNT-2, answered ### What did SURMOUNT-2 find? In SURMOUNT-2, a phase 3 trial of tirzepatide in adults (18 or older) with BMI of 27 kg/m2 or higher and type 2 diabetes with HbA1c 7-10% (53-86 mmol/mol), in seven countries (n=938), mean body weight fell 12.8% on 10 mg and 14.7% on 15 mg over 72 weeks, against 3.2% on placebo (treatment-regimen estimand; Garvey WT et al. Lancet 2023 (SURMOUNT-2)). ### What side effects were reported in SURMOUNT-2? SURMOUNT-2: The abstract reports that few adverse events led to discontinuation (under 5%) without per-arm figures. Related ## More on tirzepatide - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [SURMOUNT-1](https://www.primaralabs.com/research/trials/surmount-1) - [SURMOUNT-3](https://www.primaralabs.com/research/trials/surmount-3) - [SURMOUNT-4](https://www.primaralabs.com/research/trials/surmount-4) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Evidence Map: Tirzepatide](https://www.primaralabs.com/research/evidence#tirzepatide) - [Tirzepatide 15mg](https://www.primaralabs.com/marketplace/tirzepatide-15mg) --- URL: https://www.primaralabs.com/research/trials/surmount-3 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/surmount-3.md # SURMOUNT-3 In SURMOUNT-3, a phase 3 trial of tirzepatide in adults with BMI of 30 or more, or 27 or more with at least one obesity-related complication (excluding diabetes), who achieved 5.0% or more weight reduction after a 12-week intensive lifestyle intervention (n=579), mean body weight changed by -18.4% on maximum tolerated dose (10 or 15 mg) over 72 weeks, against +2.5% on placebo (treatment-regimen estimand; Wadden TA et al. Nat Med 2023 (SURMOUNT-3)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported In SURMOUNT-3, discontinuation because of adverse events was 10.5% on maximum tolerated dose (10 or 15 mg), against 2.1% on placebo. The most frequently reported adverse events were nausea in 39.7% on maximum tolerated dose (10 or 15 mg) against 14.0% on placebo, diarrhoea in 31.0% on maximum tolerated dose (10 or 15 mg) against 9.2% on placebo, constipation in 23.0% on maximum tolerated dose (10 or 15 mg) against 6.8% on placebo and vomiting in 18.1% on maximum tolerated dose (10 or 15 mg) against 1.4% on placebo. | Event | Maximum tolerated dose (10 or 15 mg) | Placebo | | --- | --- | --- | | Discontinuation for adverse events | 10.5% | 2.1% | | Nausea | 39.7% | 14.0% | | Diarrhoea | 31.0% | 9.2% | | Constipation | 23.0% | 6.8% | | Vomiting | 18.1% | 1.4% | Design ## Trial design and sources Compound Tirzepatide Phase 3 Population Adults with BMI of 30 or more, or 27 or more with at least one obesity-related complication (excluding diabetes), who achieved 5.0% or more weight reduction after a 12-week intensive lifestyle intervention Participants randomised 579 Duration 72 weeks Primary endpoint Coprimary: additional mean percent weight change from randomization to week 72, and percentage achieving additional weight reduction of 5% or more Estimand treatment-regimen Read out 15 October 2023 Enrolled participants who had lost 5% or more in a 12-week intensive lifestyle lead-in; figures are the additional change from randomisation. The placebo arm regained weight. - Wadden TA et al. Nat Med 2023 (SURMOUNT-3) [open](https://doi.org/10.1038/s41591-023-02597-w) · checked 23 September 2026 - ClinicalTrials.gov NCT04657016 [open](https://clinicaltrials.gov/study/NCT04657016) · checked 23 September 2026 - Registry: NCT04657016 Questions ## SURMOUNT-3, answered ### What did SURMOUNT-3 find? In SURMOUNT-3, a phase 3 trial of tirzepatide in adults with BMI of 30 or more, or 27 or more with at least one obesity-related complication (excluding diabetes), who achieved 5.0% or more weight reduction after a 12-week intensive lifestyle intervention (n=579), mean body weight changed by -18.4% on maximum tolerated dose (10 or 15 mg) over 72 weeks, against +2.5% on placebo (treatment-regimen estimand; Wadden TA et al. Nat Med 2023 (SURMOUNT-3)). ### What side effects were reported in SURMOUNT-3? In SURMOUNT-3, discontinuation because of adverse events was 10.5% on maximum tolerated dose (10 or 15 mg), against 2.1% on placebo. The most frequently reported adverse events were nausea in 39.7% on maximum tolerated dose (10 or 15 mg) against 14.0% on placebo, diarrhoea in 31.0% on maximum tolerated dose (10 or 15 mg) against 9.2% on placebo, constipation in 23.0% on maximum tolerated dose (10 or 15 mg) against 6.8% on placebo and vomiting in 18.1% on maximum tolerated dose (10 or 15 mg) against 1.4% on placebo. Related ## More on tirzepatide - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [SURMOUNT-1](https://www.primaralabs.com/research/trials/surmount-1) - [SURMOUNT-2](https://www.primaralabs.com/research/trials/surmount-2) - [SURMOUNT-4](https://www.primaralabs.com/research/trials/surmount-4) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Evidence Map: Tirzepatide](https://www.primaralabs.com/research/evidence#tirzepatide) - [Tirzepatide 15mg](https://www.primaralabs.com/marketplace/tirzepatide-15mg) --- URL: https://www.primaralabs.com/research/trials/surmount-4 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/surmount-4.md # SURMOUNT-4 In SURMOUNT-4, a phase 3 trial of tirzepatide in adults with BMI of 30 or more, or 27 or more with a weight-related complication, excluding diabetes (n=670), mean body weight changed by -5.5% on continued tirzepatide, weeks 36 to 88 over 88 weeks, against +14.0% on switched to placebo (treatment-regimen estimand; Aronne LJ et al. JAMA 2024 (SURMOUNT-4)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported In SURMOUNT-4, discontinuation because of adverse events was 1.8% on continued tirzepatide, weeks 36 to 88, against 0.9% on switched to placebo. The most frequently reported adverse events were diarrhoea in 10.7% on continued tirzepatide, weeks 36 to 88 against 4.8% on switched to placebo, nausea in 8.1% on continued tirzepatide, weeks 36 to 88 against 2.7% on switched to placebo and vomiting in 5.7% on continued tirzepatide, weeks 36 to 88 against 1.2% on switched to placebo. | Event | Continued tirzepatide, weeks 36 to 88 | Switched to placebo | | --- | --- | --- | | Discontinuation for adverse events | 1.8% | 0.9% | | Diarrhoea | 10.7% | 4.8% | | Nausea | 8.1% | 2.7% | | Vomiting | 5.7% | 1.2% | Design ## Trial design and sources Compound Tirzepatide Phase 3 Population Adults with BMI of 30 or more, or 27 or more with a weight-related complication, excluding diabetes Participants randomised 670 Duration 88 weeks Primary endpoint Mean percent change in weight from week 36 (randomization) to week 88 Estimand treatment-regimen Read out 1 January 2024 Withdrawal design: a 36-week open-label lead-in on tirzepatide, then randomisation to continue or switch to placebo. The switch-to-placebo arm regained weight. Adverse events shown are the double-blind period. - Aronne LJ et al. JAMA 2024 (SURMOUNT-4) [open](https://doi.org/10.1001/jama.2023.24945) · checked 23 September 2026 - ClinicalTrials.gov NCT04660643 [open](https://clinicaltrials.gov/study/NCT04660643) · checked 23 September 2026 - Registry: NCT04660643 Questions ## SURMOUNT-4, answered ### What did SURMOUNT-4 find? In SURMOUNT-4, a phase 3 trial of tirzepatide in adults with BMI of 30 or more, or 27 or more with a weight-related complication, excluding diabetes (n=670), mean body weight changed by -5.5% on continued tirzepatide, weeks 36 to 88 over 88 weeks, against +14.0% on switched to placebo (treatment-regimen estimand; Aronne LJ et al. JAMA 2024 (SURMOUNT-4)). ### What side effects were reported in SURMOUNT-4? In SURMOUNT-4, discontinuation because of adverse events was 1.8% on continued tirzepatide, weeks 36 to 88, against 0.9% on switched to placebo. The most frequently reported adverse events were diarrhoea in 10.7% on continued tirzepatide, weeks 36 to 88 against 4.8% on switched to placebo, nausea in 8.1% on continued tirzepatide, weeks 36 to 88 against 2.7% on switched to placebo and vomiting in 5.7% on continued tirzepatide, weeks 36 to 88 against 1.2% on switched to placebo. Related ## More on tirzepatide - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [SURMOUNT-1](https://www.primaralabs.com/research/trials/surmount-1) - [SURMOUNT-2](https://www.primaralabs.com/research/trials/surmount-2) - [SURMOUNT-3](https://www.primaralabs.com/research/trials/surmount-3) - [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) - [Evidence Map: Tirzepatide](https://www.primaralabs.com/research/evidence#tirzepatide) - [Tirzepatide 15mg](https://www.primaralabs.com/marketplace/tirzepatide-15mg) --- URL: https://www.primaralabs.com/research/trials/surmount-5 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/surmount-5.md # SURMOUNT-5 In SURMOUNT-5, a phase 3b trial of tirzepatide in adults with obesity but without type 2 diabetes (n=751), mean body weight fell 20.2% on tirzepatide, maximum tolerated dose over 72 weeks, against 13.7% on semaglutide, maximum tolerated dose (Aronne LJ et al. N Engl J Med 2025 (SURMOUNT-5)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. ## Side effects reported SURMOUNT-5: The abstract does not name the estimand or give adverse event rates. Design ## Trial design and sources Compound Tirzepatide Phase 3b Population Adults with obesity but without type 2 diabetes Participants randomised 751 Duration 72 weeks Primary endpoint Percent change in weight from baseline to week 72 Estimand Not stated in the source read Read out 11 May 2025 Head-to-head, open-label: tirzepatide (10 or 15 mg) against semaglutide (1.7 or 2.4 mg). The abstract does not name the estimand or give adverse event rates. - Aronne LJ et al. N Engl J Med 2025 (SURMOUNT-5) [open](https://doi.org/10.1056/NEJMoa2416394) · checked 23 September 2026 - ClinicalTrials.gov NCT05822830 [open](https://clinicaltrials.gov/study/NCT05822830) · checked 23 September 2026 - Registry: NCT05822830 Questions ## SURMOUNT-5, answered ### What did SURMOUNT-5 find? In SURMOUNT-5, a phase 3b trial of tirzepatide in adults with obesity but without type 2 diabetes (n=751), mean body weight fell 20.2% on tirzepatide, maximum tolerated dose over 72 weeks, against 13.7% on semaglutide, maximum tolerated dose (Aronne LJ et al. N Engl J Med 2025 (SURMOUNT-5)). ### What side effects were reported in SURMOUNT-5? SURMOUNT-5: The abstract does not name the estimand or give adverse event rates. Related ## More on tirzepatide - [TRIUMPH-5](https://www.primaralabs.com/research/trials/triumph-5) - [SURMOUNT-1](https://www.primaralabs.com/research/trials/surmount-1) - [SURMOUNT-2](https://www.primaralabs.com/research/trials/surmount-2) - [SURMOUNT-3](https://www.primaralabs.com/research/trials/surmount-3) - [SURMOUNT-4](https://www.primaralabs.com/research/trials/surmount-4) - [Evidence Map: Tirzepatide](https://www.primaralabs.com/research/evidence#tirzepatide) - [Tirzepatide 15mg](https://www.primaralabs.com/marketplace/tirzepatide-15mg) --- URL: https://www.primaralabs.com/research/trials/tesamorelin-phase-3-2007 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/tesamorelin-phase-3-2007.md # Tesamorelin phase 3 (Falutz, NEJM 2007) In Tesamorelin phase 3 (Falutz, NEJM 2007), a phase 3 trial of tesamorelin in adults with HIV and abdominal fat accumulation (86% men) (n=412), the visceral adipose tissue was -15.2% on 2 mg over 26 weeks, against +5.0% on placebo (Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results *Visceral adipose tissue* | 2 mg | \-15.2% | | Placebo | +5.0% | Triglycerides fell 50 mg per decilitre on tesamorelin and rose 9 mg per decilitre on placebo. ## Side effects reported Tesamorelin phase 3 (Falutz, NEJM 2007): The abstract reports that adverse events did not differ significantly between groups, but that more participants on tesamorelin withdrew because of an adverse event; it gives no rates. Design ## Trial design and sources Compound Tesamorelin Phase 3 Population Adults with HIV and abdominal fat accumulation (86% men) Participants randomised 412 Duration 26 weeks Primary endpoint Percent change from baseline in visceral adipose tissue on computed tomography Estimand Not stated in the source read Read out 1 December 2007 The abstract reports that adverse events did not differ significantly between groups, but that more participants on tesamorelin withdrew because of an adverse event; it gives no rates. - Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3) [open](https://doi.org/10.1056/NEJMoa072375) · checked 23 September 2026 - ClinicalTrials.gov NCT00123253 [open](https://clinicaltrials.gov/study/NCT00123253) · checked 23 September 2026 - Registry: NCT00123253 Questions ## Tesamorelin phase 3 (Falutz, NEJM 2007), answered ### What did Tesamorelin phase 3 (Falutz, NEJM 2007) find? In Tesamorelin phase 3 (Falutz, NEJM 2007), a phase 3 trial of tesamorelin in adults with HIV and abdominal fat accumulation (86% men) (n=412), the visceral adipose tissue was -15.2% on 2 mg over 26 weeks, against +5.0% on placebo (Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3)). ### What side effects were reported in Tesamorelin phase 3 (Falutz, NEJM 2007)? Tesamorelin phase 3 (Falutz, NEJM 2007): The abstract reports that adverse events did not differ significantly between groups, but that more participants on tesamorelin withdrew because of an adverse event; it gives no rates. Related ## More on tesamorelin - [Evidence Map: Tesamorelin](https://www.primaralabs.com/research/evidence#tesamorelin) - [Tesamorelin 10mg](https://www.primaralabs.com/marketplace/tesamorelin-10mg) --- URL: https://www.primaralabs.com/research/trials/reconnect Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/trials/reconnect.md # RECONNECT (studies 301 and 302) In RECONNECT (studies 301 and 302), a phase 3 trial of bremelanotide in premenopausal women with hypoactive sexual desire disorder (n=1,267), the FSFI desire domain score difference from placebo was +0.30 points on study 301, 1.75 mg and +0.42 points on study 302, 1.75 mg over 24 weeks (Kingsberg SA et al. Obstet Gynecol 2019 (RECONNECT)). Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 ## Results *FSFI desire domain score difference from placebo* | Study 301, 1.75 mg | +0.30 points | | Study 302, 1.75 mg | +0.42 points | Distress about low desire (FSDS-DAO item 13) fell 0.37 and 0.29 points more than placebo in studies 301 and 302. ## Side effects reported The most frequently reported adverse events were nausea in 40.0% on 1.75 mg, integrated phase 3 against 1.3% on placebo, flushing in 20.3% on 1.75 mg, integrated phase 3 against 1.3% on placebo, headache in 11.3% on 1.75 mg, integrated phase 3 against 1.9% on placebo and injection site reactions in 5.4% on 1.75 mg, integrated phase 3 against 0.5% on placebo (Safety profile across the clinical programme, J Womens Health 2022 (integrated double-blind phase 3, N=1,247)). The safety review reports nausea as the most common reason for stopping bremelanotide, without a rate. | Event | 1.75 mg, integrated phase 3 | Placebo | | --- | --- | --- | | Nausea | 40.0% | 1.3% | | Flushing | 20.3% | 1.3% | | Headache | 11.3% | 1.9% | | Injection site reactions | 5.4% | 0.5% | Design ## Trial design and sources Compound Bremelanotide Phase 3 Population Premenopausal women with hypoactive sexual desire disorder Participants randomised 1,267 Duration 24 weeks Primary endpoint Coprimary: change in the FSFI desire domain score and FSDS-DAO item 13 from baseline to end of study Estimand Not stated in the source read Read out 1 November 2019 Arm figures are differences from placebo, not changes from baseline. Study 302 is registered as NCT02338960. The safety review reports nausea as the most common reason for stopping bremelanotide, without a rate. - Kingsberg SA et al. Obstet Gynecol 2019 (RECONNECT) [open](https://doi.org/10.1097/AOG.0000000000003500) · checked 23 September 2026 - Safety profile across the clinical programme, J Womens Health 2022 (integrated double-blind phase 3, N=1,247) [open](https://doi.org/10.1089/jwh.2021.0191) · checked 23 September 2026 - ClinicalTrials.gov NCT02333071 [open](https://clinicaltrials.gov/study/NCT02333071) · checked 23 September 2026 - Registry: NCT02333071 Questions ## RECONNECT (studies 301 and 302), answered ### What did RECONNECT (studies 301 and 302) find? In RECONNECT (studies 301 and 302), a phase 3 trial of bremelanotide in premenopausal women with hypoactive sexual desire disorder (n=1,267), the FSFI desire domain score difference from placebo was +0.30 points on study 301, 1.75 mg and +0.42 points on study 302, 1.75 mg over 24 weeks (Kingsberg SA et al. Obstet Gynecol 2019 (RECONNECT)). ### What side effects were reported in RECONNECT (studies 301 and 302)? The most frequently reported adverse events were nausea in 40.0% on 1.75 mg, integrated phase 3 against 1.3% on placebo, flushing in 20.3% on 1.75 mg, integrated phase 3 against 1.3% on placebo, headache in 11.3% on 1.75 mg, integrated phase 3 against 1.9% on placebo and injection site reactions in 5.4% on 1.75 mg, integrated phase 3 against 0.5% on placebo (Safety profile across the clinical programme, J Womens Health 2022 (integrated double-blind phase 3, N=1,247)). The safety review reports nausea as the most common reason for stopping bremelanotide, without a rate. Related ## More on bremelanotide - [Evidence Map: Bremelanotide](https://www.primaralabs.com/research/evidence#bremelanotide) - [PT-141 10mg](https://www.primaralabs.com/marketplace/pt-141-10mg) --- URL: https://www.primaralabs.com/research/compare Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/compare.md # Three incretins, compared on the record. Figures from different trials are not a head-to-head comparison: the populations, durations and estimands differ. The head-to-head trials among these compounds are SURMOUNT-5, tirzepatide against semaglutide, completed, and TRIUMPH-5, retatrutide against tirzepatide, still running. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Comparisons ## Pick a comparison - [Retatrutide vs tirzepatide TRIUMPH-1 and SURMOUNT-1; head to head: TRIUMPH-5](https://www.primaralabs.com/research/compare/retatrutide-vs-tirzepatide) - [Tirzepatide vs semaglutide SURMOUNT-1 and STEP 1; head to head: SURMOUNT-5](https://www.primaralabs.com/research/compare/tirzepatide-vs-semaglutide) - [Retatrutide vs semaglutide TRIUMPH-1 and STEP 1; no head-to-head trial](https://www.primaralabs.com/research/compare/retatrutide-vs-semaglutide) --- URL: https://www.primaralabs.com/research/compare/retatrutide-vs-tirzepatide Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/compare/retatrutide-vs-tirzepatide.md # Retatrutide vs tirzepatide As of 23 September 2026 no head-to-head trial of retatrutide against tirzepatide has reported. The trials below are set side by side from separate studies, which is not a head-to-head result. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Mechanism ## How the two differ ### Retatrutide Retatrutide is a single peptide that activates three receptors: GIP, GLP-1 and glucagon. Lilly describes it as a first-in-class triple hormone receptor agonist. [Source](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 ### Tirzepatide Tirzepatide is a single peptide that activates two receptors: GIP (glucose-dependent insulinotropic polypeptide) and GLP-1. [Source](https://doi.org/10.1056/NEJMoa2206038) · checked 23 September 2026 Cross-trial ## Separate trials, side by side Choose two to four trials 2 selected. Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. | | [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) | [SURMOUNT-1](https://www.primaralabs.com/research/trials/surmount-1) | | --- | --- | --- | | Compound | Retatrutide | Tirzepatide | | Phase | 3 | 3 | | Population | Adults with obesity, or overweight with at least one weight-related condition, without diabetes | Adults with BMI of 30 or more, or 27 or more with at least one weight-related complication, excluding diabetes | | n | 2,339 | 2,539 | | Weeks | 80 | 72 | | Estimand | efficacy | treatment-regimen | | Arms | 4 mg: -19.0%; 9 mg: -25.9%; 12 mg: -28.3% | 5 mg: -15.0%; 10 mg: -19.5%; 15 mg: -20.9% | | Comparator | Placebo: -2.2% | Placebo: -3.1% | | Stopped for adverse events | 4 mg: 4.1%; 9 mg: 6.9%; 12 mg: 11.3%; Placebo: 4.9% | 5 mg: 4.3%; 10 mg: 7.1%; 15 mg: 6.2%; Placebo: 2.6% | | Source | Eli Lilly topline release, 21 May 2026 | Jastreboff AM et al. N Engl J Med 2022;387:205-216 | TRIUMPH-1: side effects reported In TRIUMPH-1, discontinuation because of adverse events was 4.1% on 4 mg, 6.9% on 9 mg and 11.3% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were nausea in 28.6% on 4 mg, 38.4% on 9 mg and 42.4% on 12 mg against 14.8% on placebo, diarrhoea in 25.2% on 4 mg, 34.1% on 9 mg and 32.0% on 12 mg against 13.5% on placebo, constipation in 23.8% on 4 mg, 25.9% on 9 mg and 26.1% on 12 mg against 10.9% on placebo and vomiting in 10.6% on 4 mg, 22.8% on 9 mg and 25.3% on 12 mg against 4.8% on placebo. SURMOUNT-1: side effects reported In SURMOUNT-1, discontinuation because of adverse events was 4.3% on 5 mg, 7.1% on 10 mg and 6.2% on 15 mg, against 2.6% on placebo. Figures from different trials are not a head-to-head comparison: the populations, durations and estimands differ. The head-to-head trials among these compounds are SURMOUNT-5, tirzepatide against semaglutide, completed, and TRIUMPH-5, retatrutide against tirzepatide, still running. TRIUMPH-5 is a phase 3 trial of retatrutide against tirzepatide in adults who have obesity, registered as NCT06662383 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). [Trial page](https://www.primaralabs.com/research/trials/triumph-5). Questions ## Questions ### Has retatrutide been compared head to head with tirzepatide? TRIUMPH-5 is a phase 3 trial of retatrutide against tirzepatide in adults who have obesity, registered as NCT06662383 and not yet reported (ClinicalTrials.gov, checked 23 September 2026). ### Why can the TRIUMPH-1 and SURMOUNT-1 figures not be compared directly? Figures from different trials are not a head-to-head comparison: the populations, durations and estimands differ. The head-to-head trials among these compounds are SURMOUNT-5, tirzepatide against semaglutide, completed, and TRIUMPH-5, retatrutide against tirzepatide, still running. TRIUMPH-1 reports the efficacy estimand over 80 weeks. SURMOUNT-1 reports the treatment-regimen estimand over 72 weeks. --- URL: https://www.primaralabs.com/research/compare/tirzepatide-vs-semaglutide Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/compare/tirzepatide-vs-semaglutide.md # Tirzepatide vs semaglutide In SURMOUNT-5, a phase 3b trial of tirzepatide in adults with obesity but without type 2 diabetes (n=751), mean body weight fell 20.2% on tirzepatide, maximum tolerated dose over 72 weeks, against 13.7% on semaglutide, maximum tolerated dose (Aronne LJ et al. N Engl J Med 2025 (SURMOUNT-5)). The trials below are set side by side from separate studies, which is not a head-to-head result. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Mechanism ## How the two differ ### Tirzepatide Tirzepatide is a single peptide that activates two receptors: GIP (glucose-dependent insulinotropic polypeptide) and GLP-1. [Source](https://doi.org/10.1056/NEJMoa2206038) · checked 23 September 2026 ### Semaglutide Semaglutide is a GLP-1 analogue that selectively binds to and activates the GLP-1 receptor, the target of native GLP-1. [Source](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=42bdd912-2393-44c4-b7e0-47672ca28991) · checked 23 September 2026 Head to head ## [SURMOUNT-5](https://www.primaralabs.com/research/trials/surmount-5) In SURMOUNT-5, a phase 3b trial of tirzepatide in adults with obesity but without type 2 diabetes (n=751), mean body weight fell 20.2% on tirzepatide, maximum tolerated dose over 72 weeks, against 13.7% on semaglutide, maximum tolerated dose (Aronne LJ et al. N Engl J Med 2025 (SURMOUNT-5)). ## Side effects reported SURMOUNT-5: The abstract does not name the estimand or give adverse event rates. Cross-trial ## Separate trials, side by side Choose two to four trials 2 selected. Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. | | [SURMOUNT-1](https://www.primaralabs.com/research/trials/surmount-1) | [STEP 1](https://www.primaralabs.com/research/trials/step-1) | | --- | --- | --- | | Compound | Tirzepatide | Semaglutide | | Phase | 3 | 3 | | Population | Adults with BMI of 30 or more, or 27 or more with at least one weight-related complication, excluding diabetes | Adults with BMI of 30 or greater (27 or greater with at least one weight-related coexisting condition), without diabetes | | n | 2,539 | 1,961 | | Weeks | 72 | 68 | | Estimand | treatment-regimen | treatment-policy | | Arms | 5 mg: -15.0%; 10 mg: -19.5%; 15 mg: -20.9% | 2.4 mg: -14.9% | | Comparator | Placebo: -3.1% | Placebo: -2.4% | | Stopped for adverse events | 5 mg: 4.3%; 10 mg: 7.1%; 15 mg: 6.2%; Placebo: 2.6% | Not published in the source read | | Source | Jastreboff AM et al. N Engl J Med 2022;387:205-216 | Wilding JPH et al. N Engl J Med 2021;384:989-1002 | SURMOUNT-1: side effects reported In SURMOUNT-1, discontinuation because of adverse events was 4.3% on 5 mg, 7.1% on 10 mg and 6.2% on 15 mg, against 2.6% on placebo. STEP 1: side effects reported STEP 1: Discontinuation for adverse events is not given in the abstract; discontinuation for gastrointestinal adverse events was 4.5% against 0.8% on placebo. Figures from different trials are not a head-to-head comparison: the populations, durations and estimands differ. The head-to-head trials among these compounds are SURMOUNT-5, tirzepatide against semaglutide, completed, and TRIUMPH-5, retatrutide against tirzepatide, still running. Questions ## Questions ### Has tirzepatide been compared head to head with semaglutide? In SURMOUNT-5, a phase 3b trial of tirzepatide in adults with obesity but without type 2 diabetes (n=751), mean body weight fell 20.2% on tirzepatide, maximum tolerated dose over 72 weeks, against 13.7% on semaglutide, maximum tolerated dose (Aronne LJ et al. N Engl J Med 2025 (SURMOUNT-5)). ### Why can the SURMOUNT-1 and STEP 1 figures not be compared directly? Figures from different trials are not a head-to-head comparison: the populations, durations and estimands differ. The head-to-head trials among these compounds are SURMOUNT-5, tirzepatide against semaglutide, completed, and TRIUMPH-5, retatrutide against tirzepatide, still running. SURMOUNT-1 reports the treatment-regimen estimand over 72 weeks. STEP 1 reports the treatment-policy estimand over 68 weeks. --- URL: https://www.primaralabs.com/research/compare/retatrutide-vs-semaglutide Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/research/compare/retatrutide-vs-semaglutide.md # Retatrutide vs semaglutide As of 23 September 2026 no head-to-head trial of retatrutide against semaglutide has reported. The trials below are set side by side from separate studies, which is not a head-to-head result. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Mechanism ## How the two differ ### Retatrutide Retatrutide is a single peptide that activates three receptors: GIP, GLP-1 and glucagon. Lilly describes it as a first-in-class triple hormone receptor agonist. [Source](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 ### Semaglutide Semaglutide is a GLP-1 analogue that selectively binds to and activates the GLP-1 receptor, the target of native GLP-1. [Source](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=42bdd912-2393-44c4-b7e0-47672ca28991) · checked 23 September 2026 Cross-trial ## Separate trials, side by side Choose two to four trials 2 selected. Mean percent change in body weight by arm, as each source reports it. Bars from different trials are not a head-to-head comparison: populations, durations and estimands differ. | | [TRIUMPH-1](https://www.primaralabs.com/research/trials/triumph-1) | [STEP 1](https://www.primaralabs.com/research/trials/step-1) | | --- | --- | --- | | Compound | Retatrutide | Semaglutide | | Phase | 3 | 3 | | Population | Adults with obesity, or overweight with at least one weight-related condition, without diabetes | Adults with BMI of 30 or greater (27 or greater with at least one weight-related coexisting condition), without diabetes | | n | 2,339 | 1,961 | | Weeks | 80 | 68 | | Estimand | efficacy | treatment-policy | | Arms | 4 mg: -19.0%; 9 mg: -25.9%; 12 mg: -28.3% | 2.4 mg: -14.9% | | Comparator | Placebo: -2.2% | Placebo: -2.4% | | Stopped for adverse events | 4 mg: 4.1%; 9 mg: 6.9%; 12 mg: 11.3%; Placebo: 4.9% | Not published in the source read | | Source | Eli Lilly topline release, 21 May 2026 | Wilding JPH et al. N Engl J Med 2021;384:989-1002 | TRIUMPH-1: side effects reported In TRIUMPH-1, discontinuation because of adverse events was 4.1% on 4 mg, 6.9% on 9 mg and 11.3% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were nausea in 28.6% on 4 mg, 38.4% on 9 mg and 42.4% on 12 mg against 14.8% on placebo, diarrhoea in 25.2% on 4 mg, 34.1% on 9 mg and 32.0% on 12 mg against 13.5% on placebo, constipation in 23.8% on 4 mg, 25.9% on 9 mg and 26.1% on 12 mg against 10.9% on placebo and vomiting in 10.6% on 4 mg, 22.8% on 9 mg and 25.3% on 12 mg against 4.8% on placebo. STEP 1: side effects reported STEP 1: Discontinuation for adverse events is not given in the abstract; discontinuation for gastrointestinal adverse events was 4.5% against 0.8% on placebo. Figures from different trials are not a head-to-head comparison: the populations, durations and estimands differ. The head-to-head trials among these compounds are SURMOUNT-5, tirzepatide against semaglutide, completed, and TRIUMPH-5, retatrutide against tirzepatide, still running. Questions ## Questions ### Has retatrutide been compared head to head with semaglutide? No head-to-head trial of retatrutide against semaglutide is in the Research Desk trials dataset as of 23 September 2026. The figures on this page come from separate trials. ### Why can the TRIUMPH-1 and STEP 1 figures not be compared directly? Figures from different trials are not a head-to-head comparison: the populations, durations and estimands differ. The head-to-head trials among these compounds are SURMOUNT-5, tirzepatide against semaglutide, completed, and TRIUMPH-5, retatrutide against tirzepatide, still running. TRIUMPH-1 reports the efficacy estimand over 80 weeks. STEP 1 reports the treatment-policy estimand over 68 weeks. --- URL: https://www.primaralabs.com/batch/reta-4728-a Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/batch/reta-4728-a.md # Batch RETA-4728-A Retatrutide batch RETA-4728-A is Janoshik-tested for bacterial endotoxin: 6.066 EU per vial, analysed 21 September 2026 (task 234146, key H2KI86I8GWB4). This report covers bacterial endotoxin only. It does not establish identity or purity. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Janoshik ## Bacterial endotoxin: 6.066 EU per vial This report covers bacterial endotoxin only. It does not establish identity or purity. Compound Retatrutide Analysed 21 September 2026 Task number 234146 Verification key H2KI86I8GWB4 Test Bacterial endotoxin (LAL) Result Endotoxin: 6.066 EU per vial [Verify at Janoshik](https://verify.janoshik.com/tests/234146_H2KI86I8GWB4)[The row on /coa](https://www.primaralabs.com/coa#retatrutide-reta-4728-a)[Retatrutide product page](https://www.primaralabs.com/marketplace/retatrutide) --- URL: https://www.primaralabs.com/coa Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/coa.md # Testing, batch by batch. Primara Labs batch reports: each laboratory report is published here per batch, with the laboratory's own verification key as plain text and a link to its verification page. The first is Janoshik's bacterial endotoxin report for retatrutide batch RETA-4728-A, analysed 21 September 2026. Issued ## Reports, with the laboratory's own key ### Retatrutide · Bacterial endotoxin · RETA-4728-A This report covers bacterial endotoxin only. It does not establish identity or purity. Laboratory Janoshik Compound [Retatrutide](https://www.primaralabs.com/marketplace/retatrutide) Batch RETA-4728-A Analysis date 21 September 2026 Test Bacterial endotoxin (LAL) Covers Bacterial endotoxin only Result Endotoxin: 6.066 EU per vial Ordered, received 12 September 2026, 17 September 2026 Task number 234146 Verification key H2KI86I8GWB4 [Verify at Janoshik](https://verify.janoshik.com/tests/234146_H2KI86I8GWB4)[Report as issued](https://www.primaralabs.com/coa/janoshik-234146.png)Reading an endotoxin result https://verify.janoshik.com/tests/234146\_H2KI86I8GWB4 The report as Janoshik issued it. The key printed at its foot is the one above. Endotoxin ## Reading an endotoxin result Endotoxin is a fragment of the outer wall of certain bacteria. It remains after bacteria are killed or filtered out, so a sterile material can still carry it. Laboratories measure it with the LAL test and report it in endotoxin units (EU), a measure of biological activity rather than weight. Janoshik reports endotoxin per vial. Retatrutide batch RETA-4728-A measured 6.066 EU per vial. The pharmacopeial threshold used for parenteral materials is 5 EU per kilogram of body weight per hour. When comparing results between sellers, check the unit first. Per vial, per mg and per mL figures are not interchangeable. This result does not show identity, amount or purity. Reports covering those will be published on this page per batch as they are issued. ### What is an endotoxin unit (EU)? An endotoxin unit is a measure of the biological activity of bacterial endotoxin, not of its weight. Laboratories derive it from the LAL test, and Janoshik reports it per vial. ### Why is sterile not the same as endotoxin-free? Sterile means no living microorganisms. Endotoxin is a fragment of the outer wall of certain bacteria that remains after they are killed or filtered out, so a sterile material can still carry it. ### What does the retatrutide endotoxin report not cover? This report covers bacterial endotoxin only. It does not establish identity or purity. It says nothing about amount either. Reports covering identity, amount and purity will be published on this page per batch as they are issued. How to read this page ## What a row says, and what it does not Every row names what its report covers and what it does not establish. A report that carries no figure for something is described that way here rather than with a threshold or a range. The batch number on your vial is what a row is matched to. ## Checking a report yourself Where a laboratory issues a public reference, the row carries it as text and as a link to the laboratory's own page. Compare what the laboratory shows with what this row shows; if they differ, the laboratory is right and we correct the row. [What we do and do not claim](https://www.primaralabs.com/trust)[Editorial standards](https://www.primaralabs.com/editorial-standards)[Guarantee](https://www.primaralabs.com/guarantee)[Reviews, word for word](https://www.primaralabs.com/reviews)[Catalogue](https://www.primaralabs.com/marketplace) --- URL: https://www.primaralabs.com/tools/lab-test-planner Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/tools/lab-test-planner.md # Which test answers your question? As of 23 September 2026, the planner holds 70 tests from 5 independent analytical laboratories, each read from the laboratory's own website with its published US dollar price, turnaround and sample requirements. Choose a compound and a question to see the matching tests. Nothing you enter here is sent anywhere. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Planner ## Plan a test CompoundQuestion Identity: what the report will and will not tell you An identity test checks that the substance is the compound named. Mass spectrometry measures the molecule's mass directly; an HPLC identity check compares how long the sample takes to pass through a column against a reference standard, which is weaker evidence on its own. Janoshik Analytical Accepts samples from anywhere in the world, per its own site. Its only test labelled blind is the common GLP-1 blind test. Blend analyses measure identity and amount but not purity. Blind testing: With blind testing, you do not need to tell us which of the three peptides you suspect to be in your vial. The test will identify the peptide, all the while accurately measuring it’s amount in the vial and peptide purity. - [Common GLP-1 peptide blind test (Semaglutide, Tirzepatide and Retatrutide)](https://janoshik.com/pricelist/common-glp-1-peptide-blind-test-semaglutide-tirzepatide-and-retatrutide/)US$360 Most popular test of GLP-1 peptides – blind test of semaglutide, tirzepatide, and retatrutide. Providing you with ID, amount and peptide purity of your sample. With blind testing, you do not need to tell us which of the three peptides you suspect to be in your vial. The test will identify the peptide, all the while accurately measuring it’s amount in the vial and peptide purity. In case of a mixture of the three, ID and amount of all will be analyzed. | Testing method: HPLC | Detection limit cutoff: less than 1/20th of the usual dosage per vial | Result format (lyophilizate): mg per vial and peptide purity | Result format (alternative): m/m purity and peptide purity Does not cover: Important notice: In case the peptides are mixed together in the sample, measurement of peptide purity might not be possible. Average turnaround time: 7 business days · Minimum amount for the test (lyophilizate): 1 whole unopened vial with lyophilizate; Minimum amount for the test (raw API powder): 30mg in sealed glass vial to prevent the sample from absorbing moisture - [LCMS Screening For Peptide Contamination (additional service)](https://janoshik.com/pricelist/bpc-157-analysis/)US$205 LCMS testing can detect contamination of peptide products with other peptides and degraded peptide. Detection is limited to peptides on our price list. You can ask our customer support for the full list, Test gives only identification. Measurement of concentration can be offered for an additional price once contamination is detected. Does not cover: Detection is limited to peptides on our price list. You can ask our customer support for the full list, Test gives only identification. Measurement of concentration can be offered for an additional price once contamination is detected. Turnaround not published · GCMS and LCMS - no additional piece of sample is necessary - [GCMS/LCMS screening for contamination](https://janoshik.com/pricelist/gcms-lcms-screening-for-contamination/)US$205 Standalone GCMS or LCMS screening for contamination of the sample. The type of analysis depends o the type of sample. Our lab team will determine which method is best for your sample. LCMS testing can detect contamination of peptide products with other peptides and degraded peptide. | Testing method: GCMS or LCMS Does not cover: Detection is limited to volatile and semi-volatile compounds and the test cannot be used on peptide samples. Detection is limited to peptides on our price list (you can ask our customer support for the full list). Both tests give only identification of contaminants. Measurement of concentration can be offered for additional price once such substance is detected. Average turnaround time: 7 business days · Amount of sample required: 1 tab/caps or 1 ml solution or 200 mg raw or 1 vial Accumark Labs States US sample intake. Identity is by HPLC; LC-MS identity is listed as in development. No sample quantity is stated. - [Core Panel (Identity, Purity & Quantity)](https://accumarklabs.com/services/)US$250 HPLC Identity Confirmation | Purity Analysis (%) | Quantity Verification (mg) | Digital + PDF Certificate | Cryptographically Immutable Standard results typically in 2 business days from sample receipt. | Typical turnaround time for standard analytical services is 48–72 hours after sample acceptance. - [AccuShield Panel (Core + Full Biosafety Suite)](https://accumarklabs.com/services/)US$578 Everything in Core Panel | Endotoxin (LAL) Testing | Sterility (PCR) Testing | Satisfaction Guaranteed Turnaround not published ACS Peptide Testing Labs (ACS Laboratory) Publishes price ranges only; the final price is by quote. Its FAQ page gives different figures from its cost page. States US intake, with customs guidance for international shipments. - [Identity confirmation](https://acslabtest.com/peptide-testing-cost)US$200 to 400, by quote Monoisotopic mass and sequence confirmation. Most COAs pair this with HPLC purity. | Method: LC-MS/MS Orbitrap Turnaround is 9 to 11 business days at one price for every customer. · Sample needed: 0.5–1 mg lyophilized peptide (molecular-analysis page) - [Third-party COA verification](https://acslabtest.com/peptide-testing-cost)US$300 to 600, by quote Independent re-test of a supplier COA, with a side-by-side discrepancy summary. | Method: HPLC + LC-MS against supplied COA Turnaround is 9 to 11 business days at one price for every customer. - [Purity + Identity (bundle)](https://acslabtest.com/peptide-testing-cost)US$350 to 650, by quote The laboratory's default panel: HPLC purity plus LC-MS identity. Turnaround is 9 to 11 business days at one price for every customer. - [Compounding release panel (bundle)](https://acslabtest.com/peptide-testing-cost)US$800 to 1600, by quote Purity, identity, endotoxin, and moisture. Turnaround is 9 to 11 business days at one price for every customer. - [Full contaminant screen (bundle)](https://acslabtest.com/peptide-testing-cost)US$1000 to 2000, by quote Everything in the release panel plus ICP-MS heavy metals and GC-HS residual solvents. Turnaround is 9 to 11 business days at one price for every customer. · Comprehensive Contaminant Panel (endotoxin, heavy metals, residual solvents): Sample required: 5–10 mg (endotoxin-testing page) ILS Laboratories States US sample intake. Identity is by HPLC retention time; LC-MS identity is an unpriced add-on. Only the two panels are priced. - [Full QC Panel](https://ils-lab.com/services/peptide-testing/)US$600 Purity & Quantitation (HPLC) | Identity Confirmation (HPLC Retention Time Matching) | Endotoxin (USP <85>) | Heavy Metals (ICP-MS) | Rapid Sterility Screen (DNA Microarray) ~1 week. Rush: 3 business days from lab receipt; receipt date is Day 0 · Minimum 10 mg per sample. The Full QC Panel requires a minimum of 10 mg of material to complete all five tests across the different test groups. 3 vials recommended per sample. Under 10 mg? Send 4 vials. Lyophilized (freeze-dried) powder is the preferred sample form. Reconstituted solutions are also accepted. - [HPLC Panel](https://ils-lab.com/services/peptide-testing/)US$200 A focused panel for HPLC identity, purity, and quantitation. | HPLC retention-time identity | Purity assessment | Quantitation ~1 week - [Identity Confirmation (a la carte)](https://ils-lab.com/services/peptide-testing/)Price not published HPLC-based identity confirmation by retention time matching against reference standards. Results confirm the sample matches the expected compound. | HPLC Retention Time Matching (RTM) ~1 week - [LC-MS Identity (Custom Add-On)](https://ils-lab.com/services/peptide-testing/)Price not published Listed under A La Carte Testing as an additional add-on analysis. ~1 week Vanguard Laboratory Its price page does not state how purity or identity are measured. The same site runs a programme that promotes peptide suppliers, which bears on its independence. - [Level 1 Silver](https://vanguardlaboratory.com/peptide-testing/)US$250 Silver includes purity, quantity, identity and solubility. | 4 checks · 1 vial per sample Turnaround depends on the selected tests and is confirmed by the laboratory. · 1 vial per sample - [Level 2 Gold](https://vanguardlaboratory.com/peptide-testing/)US$550 Gold adds endotoxins, bioburden, fentanyl screening and vial seal integrity. | Purity, Quantity, Identity, Solubility, Endotoxins, Bioburden (USP 61), Fentanyl Screening, Vial Seal Integrity | 8 checks · 3 vials per sample Does not cover: Bioburden is not sterility. Turnaround depends on the selected tests and is confirmed by the laboratory. · 3 vials per sample - [Level 3 Elite](https://vanguardlaboratory.com/peptide-testing/)US$700 Elite also adds heavy metals. | All eight Gold checks | Heavy Metals Screening | 9 checks · 4 vials per sample Does not cover: Sterility and conformity are optional Turnaround depends on the selected tests and is confirmed by the laboratory. · 4 vials per sample [Download JSON](https://www.primaralabs.com/data/lab-tests.json)[Download CSV](https://www.primaralabs.com/data/lab-tests.csv) Blind testing ## Why a blind test is stronger In a blind test the laboratory is not told which compound to expect and has to identify it. That is stronger than a test that confirms a compound named in advance, because a named-target test can only say whether the expected compound is present. Guarantee ## If a test disagrees with the label 60-day money-back guarantee: if an accredited independent laboratory reports that a vial is not the compound on the label, or reports purity below the certificate published for that product, the purchase price is refunded. [How the guarantee works](https://www.primaralabs.com/guarantee). Method ## Where the prices come from Methodology Every test, price and turnaround was read from the laboratory's own pages on 23 September 2026; each row links to the page it came from. A price the laboratory publishes only as a range is shown as a range; one it does not publish is shown as not published. Prices change: check the laboratory's page before ordering. The planner names laboratories, not sellers, and does not rank them. Cite this Primara Labs Research Desk, "Peptide laboratory tests and prices", last updated 23 September 2026, https://www.primaralabs.com/tools/lab-test-planner --- URL: https://www.primaralabs.com/tools/coa-reader Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/tools/coa-reader.md # Check a lab report against the laboratory's own record. A certificate of analysis is only as good as the laboratory's own copy of it. This tool builds the verification address for a Janoshik report from its task number and key, lists what to compare, explains what each kind of test does and does not show, and converts an endotoxin figure between per vial and per mg. **Nothing you enter here is sent anywhere.** Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Tool ## Read a report ### Open the laboratory's record Laboratory Janoshik prints a task number and a unique key on every report. The verification page shows the laboratory's own copy of the report. Task numberVerification key Enter a task number (digits) and key (letters and digits) to build the address. ### Endotoxin: per vial to per mg Some reports give endotoxin per vial, others per mg. To compare them, divide the per-vial figure by the milligrams of compound in the vial. EU per vialmg in the vial EU per mg: enter both figures The pharmacopeial threshold used for parenteral materials is 5 EU per kilogram of body weight per hour. Checklist ## What to compare 1. 1\. Compound The sample name on the laboratory's record should be the compound on the vial, not a related one. 2. 2\. Batch The batch on the record should match the batch printed on the vial in hand. A report for another batch says nothing about this one. 3. 3\. What the test covers An endotoxin test says nothing about identity or purity; an identity test says nothing about endotoxin. Read the tests requested line. 4. 4\. The figure and its unit The result should match what the seller quotes, in the same unit. Per vial, per mg and per mL are not interchangeable. 5. 5\. Dates Check the order, receipt and analysis dates, and that the analysis is recent enough to describe the stock being sold. 6. 6\. Client name The client on the record is who sent the sample. It tells you who commissioned the test, not who made the product. Tests ## What each test covers Identity An identity test checks that the substance is the compound named. Mass spectrometry measures the molecule's mass directly; an HPLC identity check compares how long the sample takes to pass through a column against a reference standard, which is weaker evidence on its own. Purity A purity result, usually by HPLC, is the share of the detected material that is the target compound. It does not by itself prove what that compound is, which is why purity is normally paired with an identity test. Amount in the vial A quantity result states how much of the compound the vial holds, usually in milligrams. A vial can be pure and still hold less than its label says. Endotoxin An endotoxin test, usually the LAL assay, measures bacterial endotoxin in endotoxin units. It does not show identity, amount or purity. Heavy metals A heavy metals screen, usually by ICP-MS, measures metals such as lead, cadmium, arsenic and mercury. It says nothing about the peptide itself. Sterility A sterility or microbial test checks for living bacteria and fungi. A sterile sample can still carry endotoxin, which is measured separately. Identity and purity ## Purity is not identity, and a blind test is stronger A purity result, usually by HPLC, is the share of the detected material that is the target compound. It does not by itself prove what that compound is, which is why purity is normally paired with an identity test. An identity test checks that the substance is the compound named. Mass spectrometry measures the molecule's mass directly; an HPLC identity check compares how long the sample takes to pass through a column against a reference standard, which is weaker evidence on its own. In a blind test the laboratory is not told which compound to expect and has to identify it. That is stronger than a test that confirms a compound named in advance, because a named-target test can only say whether the expected compound is present. --- URL: https://www.primaralabs.com/tools/delivery-checker Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/tools/delivery-checker.md # Does Primara Labs deliver to you, and when? As of 23 September 2026, Primara Labs lists 49 named cities and provinces across 6 delivery groups. Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Updated 23 September 2026 Check an area ## Type a city or province City or province Type at least two letters of a city or province to see its delivery window, courier and fee. Courier is free on orders over ₱10,000 anywhere in the Philippines. Below that, a Metro Manila rider is ₱150, J&T Express is ₱250 to Luzon and the Visayas and ₱300 to Mindanao. 17 areas ## Metro Manila All 17 cities and municipalities of the National Capital Region. Confirmed before 12 noon on a weekday, it goes out on the same run. | Area | Window | Courier | Fee | Timing | | --- | --- | --- | --- | --- | | [Caloocan](https://www.primaralabs.com/buy-peptides/caloocan) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Las Piñas](https://www.primaralabs.com/buy-peptides/las-pinas) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Makati](https://www.primaralabs.com/buy-peptides/makati) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | Malabon | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Mandaluyong](https://www.primaralabs.com/buy-peptides/mandaluyong) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Manila](https://www.primaralabs.com/buy-peptides/manila) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Marikina](https://www.primaralabs.com/buy-peptides/marikina) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Muntinlupa](https://www.primaralabs.com/buy-peptides/alabang-muntinlupa) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | Navotas | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Parañaque](https://www.primaralabs.com/buy-peptides/paranaque) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Pasay](https://www.primaralabs.com/buy-peptides/pasay) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Pasig](https://www.primaralabs.com/buy-peptides/ortigas-pasig) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | Pateros | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Quezon City](https://www.primaralabs.com/buy-peptides/quezon-city) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [San Juan](https://www.primaralabs.com/buy-peptides/san-juan) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Taguig](https://www.primaralabs.com/buy-peptides/bgc-taguig) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | | [Valenzuela](https://www.primaralabs.com/buy-peptides/valenzuela) | Same day | Grab Express / Lalamove | ₱150 | Orders confirmed before 12 noon on a weekday go out the same day. | 7 areas ## Central Luzon North out of the metro on NLEX and SCTEX. Malolos, San Fernando, Angeles and Balanga usually land the next day. | Area | Window | Courier | Fee | Timing | | --- | --- | --- | --- | --- | | [Bulacan](https://www.primaralabs.com/buy-peptides/bulacan) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Pampanga (Angeles, Clark)](https://www.primaralabs.com/buy-peptides/pampanga-clark) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Bataan](https://www.primaralabs.com/buy-peptides/bataan) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Tarlac](https://www.primaralabs.com/buy-peptides/tarlac) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Nueva Ecija](https://www.primaralabs.com/buy-peptides/nueva-ecija) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Zambales (Olongapo, Subic)](https://www.primaralabs.com/buy-peptides/zambales-subic) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | Aurora | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | 8 areas ## South Luzon South and east through Calabarzon, then down into Bicol. Cavite, Laguna and Rizal are close enough that most orders arrive the next day; Bicol and Palawan sit at the far end of the Luzon window. | Area | Window | Courier | Fee | Timing | | --- | --- | --- | --- | --- | | [Cavite](https://www.primaralabs.com/buy-peptides/cavite) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Laguna](https://www.primaralabs.com/buy-peptides/laguna) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Batangas](https://www.primaralabs.com/buy-peptides/batangas) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Rizal](https://www.primaralabs.com/buy-peptides/rizal) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Quezon (Lucena)](https://www.primaralabs.com/buy-peptides/lucena) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Albay (Legazpi)](https://www.primaralabs.com/buy-peptides/legazpi) | 2 to 3 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Camarines Sur (Naga)](https://www.primaralabs.com/buy-peptides/naga) | 2 to 3 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Palawan (Puerto Princesa)](https://www.primaralabs.com/buy-peptides/palawan) | 2 to 4 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | 4 areas ## North Luzon Up through Central Luzon on TPLEX, then into the Cordillera or the Cagayan Valley, so allow the far end of the window rather than the front of it. | Area | Window | Courier | Fee | Timing | | --- | --- | --- | --- | --- | | [Pangasinan (Dagupan)](https://www.primaralabs.com/buy-peptides/pangasinan) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [La Union (San Fernando)](https://www.primaralabs.com/buy-peptides/la-union) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Baguio (Benguet)](https://www.primaralabs.com/buy-peptides/baguio) | 2 to 3 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | | [Isabela (Cauayan, Ilagan)](https://www.primaralabs.com/buy-peptides/isabela) | 2 to 3 business days | J&T Express | ₱250 | Parcels for Luzon leave Metro Manila Monday to Saturday. | 7 areas ## Visayas Air leg out of Manila, then a J&T van, so these typically arrive on the second or third day. Parcels leave Monday to Wednesday only. | Area | Window | Courier | Fee | Timing | | --- | --- | --- | --- | --- | | [Cebu](https://www.primaralabs.com/buy-peptides/cebu) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Visayas leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | | [Mactan (Lapu-Lapu)](https://www.primaralabs.com/buy-peptides/cebu-mactan) | 1 to 2 business days | J&T Express | ₱250 | Parcels for Visayas leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | | [Iloilo](https://www.primaralabs.com/buy-peptides/iloilo) | 2 to 3 business days | J&T Express | ₱250 | Parcels for Visayas leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | | [Bacolod](https://www.primaralabs.com/buy-peptides/bacolod) | 2 to 3 business days | J&T Express | ₱250 | Parcels for Visayas leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | | [Dumaguete](https://www.primaralabs.com/buy-peptides/dumaguete) | 2 to 3 business days | J&T Express | ₱250 | Parcels for Visayas leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | | [Bohol (Tagbilaran, Panglao)](https://www.primaralabs.com/buy-peptides/bohol) | 2 to 3 business days | J&T Express | ₱250 | Parcels for Visayas leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | | [Leyte (Tacloban)](https://www.primaralabs.com/buy-peptides/tacloban) | 2 to 3 business days | J&T Express | ₱250 | Parcels for Visayas leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | 6 areas ## Mindanao Air leg out of Manila, then a J&T van across a large island. Davao is on a direct lane; the rest run to the far end of the window. Parcels leave Monday to Wednesday only. | Area | Window | Courier | Fee | Timing | | --- | --- | --- | --- | --- | | [Davao](https://www.primaralabs.com/buy-peptides/davao) | 2 to 3 business days | J&T Express | ₱300 | Parcels for Mindanao leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | | [Cagayan de Oro](https://www.primaralabs.com/buy-peptides/cagayan-de-oro) | 3 to 5 business days | J&T Express | ₱300 | Parcels for Mindanao leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | | [General Santos](https://www.primaralabs.com/buy-peptides/general-santos) | 3 to 5 business days | J&T Express | ₱300 | Parcels for Mindanao leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | | [Zamboanga](https://www.primaralabs.com/buy-peptides/zamboanga) | 3 to 5 business days | J&T Express | ₱300 | Parcels for Mindanao leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | | [Iligan](https://www.primaralabs.com/buy-peptides/iligan) | 3 to 5 business days | J&T Express | ₱300 | Parcels for Mindanao leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | | [Butuan](https://www.primaralabs.com/buy-peptides/butuan) | 3 to 5 business days | J&T Express | ₱300 | Parcels for Mindanao leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. | More ## Delivery terms - [Delivery terms](https://www.primaralabs.com/delivery) - [Delivery area pages](https://www.primaralabs.com/buy-peptides) - [Same-day delivery in Metro Manila](https://www.primaralabs.com/answers/can-peptides-be-delivered-same-day-in-metro-manila) --- URL: https://www.primaralabs.com/tools/supplier-checklist Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/tools/supplier-checklist.md # How to check any peptide seller in the Philippines. As of 23 September 2026, these are ten checks a buyer can apply to any peptide seller in the Philippines before paying: verifiable lab reports, what each report covers, whose sample it was, batch numbers, honest regulatory status, where stock is held, delivery, payment, published prices and a contact route. Mark them as you go; nothing you enter here is sent anywhere. Updated 23 September 2026 Your seller ## Mark each check 1. Check 1 Published lab reports with verification keys 2. Check 2 What each report covers 3. Check 3 The client name on the report 4. Check 4 Batch numbers that match the vial 5. Check 5 Honesty about regulatory status 6. Check 6 A stated stock location 7. Check 7 Delivery evidence 8. Check 8 Payment options 9. Check 9 Published prices 10. Check 10 A real contact route Your summary 0 of 10 checks met, 10 not marked yet. Nothing you enter here is sent anywhere. The ten checks ## Why each matters, and how to check it 1. Published lab reports with verification keys Why it matters. A report image can be edited or reused. A verification key lets you open the laboratory's own copy, which the seller cannot change. How to check. Find the seller's lab reports on its site, not only in a chat. Each should carry a task number and a key or link that opens the report on the laboratory's own website. Open it yourself rather than following a link the seller sends. 2. What each report covers Why it matters. An endotoxin test says nothing about identity or purity, and a purity figure says nothing about whether the compound is the right one. A report is only evidence of what it measured. How to check. Read the tests requested line on the laboratory's record. Match each claim the seller makes to a test that measured it; a claim with no test behind it is only a claim. 3. The client name on the report Why it matters. The client is whoever sent the sample. It tells you who commissioned the test, not who made or sold the product in your hands. How to check. Check the client name on the laboratory's own record. A report commissioned by someone else, or by a manufacturer for a different batch, is not evidence about this seller's stock. 4. Batch numbers that match the vial Why it matters. A report describes one batch. A report for another batch, however good, says nothing about the vial you receive. How to check. Compare the batch printed on the vial in hand with the batch on the report. Ask which batch you will receive before paying. 5. Honesty about regulatory status Why it matters. A research vial is not an approved medicine. A seller that calls one FDA approved, or says it is the same as a branded prescription product, is misstating what it sells. How to check. Look for the words approved, FDA registered or same as a named brand, and check them against the regulator's own records. Honest sellers state the status beside the price. 6. A stated stock location Why it matters. Stock already in the country ships in days; stock ordered from abroad after you pay can take weeks and pass through customs. How to check. Look for where the seller says its stock is held, and whether the delivery times it quotes are consistent with that. 7. Delivery evidence Why it matters. Named couriers and published delivery windows can be checked against what actually happens; vague promises cannot. How to check. Look for the couriers the seller uses and the delivery window per region, then compare them with what other buyers report. 8. Payment options Why it matters. Payment methods tied to a named account leave a trail; a seller that will only take an untraceable transfer leaves you nothing to dispute. How to check. Look for the payment methods listed on the site before you chat, and whether the name on the account matches the business. 9. Published prices Why it matters. A price you can see before messaging is a price that cannot change mid-conversation. Prices given only in chat are harder to compare and easier to move. How to check. Check that every product has a price on the site, in pesos, with the vial size stated. 10. A real contact route Why it matters. A seller you can reach after the sale is a seller you can hold to a promise. A chat handle that disappears is not. How to check. Look for more than one contact route and a stated business location, and check that they are the same everywhere the seller appears. Primara Labs ## How Primara answers these checks The same ten checks, applied to Primara Labs, each answered from the file that holds the fact and linked to the page that shows the evidence. 1. Published lab reports with verification keys Retatrutide batch RETA-4728-A is Janoshik-tested for bacterial endotoxin: 6.066 EU per vial, analysed 21 September 2026 (task 234146, key H2KI86I8GWB4). This report covers bacterial endotoxin only. It does not establish identity or purity. The key opens the laboratory's own record. [Evidence: Batch reports](https://www.primaralabs.com/coa) 2. What each report covers Every Primara report states its scope. This report covers bacterial endotoxin only. It does not establish identity or purity. [Evidence: Batch reports](https://www.primaralabs.com/coa) 3. The client name on the report Open the verification key on the batch reports page and read the client name on the laboratory's own record. [Evidence: Batch reports](https://www.primaralabs.com/coa) 4. Batch numbers that match the vial Each Primara report is tied to a batch, such as RETA-4728-A, and each batch has its own page listing every report for it. [Evidence: Batch lookup](https://www.primaralabs.com/batch) 5. Honesty about regulatory status Every Primara product page states the compound's status with FDA Philippines and the US FDA beside the price, and its EMA status in the regulatory section below, all read from the Research Desk's dated regulatory dataset. [Evidence: Regulatory Status Tracker](https://www.primaralabs.com/research/status) 6. A stated stock location Primara Labs states that its stock is held in Metro Manila cold storage rather than ordered in after purchase. [Evidence: Fact sheet](https://www.primaralabs.com/facts#stock) 7. Delivery evidence Rider delivery by Grab Express or Lalamove. Courier delivery by J&T Express. Metro Manila orders placed before 12 noon on a weekday arrive the same day; elsewhere, Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. [Evidence: Delivery](https://www.primaralabs.com/delivery) 8. Payment options Pay by GCash, Maya or QR Ph bank transfer in the Philippines, or by Wise, Zelle, US bank transfer or crypto from abroad. Confirmed in chat. No card checkout. Cash on delivery is available on request, subject to the conditions in our terms. [Evidence: Payment methods](https://www.primaralabs.com/international/payments) 9. Published prices Every one of the 17 products in the Primara catalogue has its peso price and vial size on its product page. [Evidence: Catalogue](https://www.primaralabs.com/marketplace) 10. A real contact route Primara Labs answers on WhatsApp (https://wa.me/639631931789) and by email at hello@primaralabs.com, and publishes its facts in one place. [Evidence: Fact sheet](https://www.primaralabs.com/facts#contact) Questions ## Common questions ### How do you know if a peptide seller in the Philippines is legit? Check what the seller publishes rather than what it says in chat: laboratory reports you can verify on the laboratory's own site, what each report covers, batch numbers that match the vial, honest regulatory status, a stated stock location, named couriers, traceable payment, published prices and a contact route that lasts. ### What should a peptide lab report show? The laboratory's name, a task number and a verification key, the batch, the tests requested, the result with its unit, the dates, and the client who sent the sample. Open the key on the laboratory's own site to confirm the report is real. ### Is a lab report from the manufacturer enough? Only for the batch it names. A report describes one batch, commissioned by the client named on it; it says nothing about a different batch or a different seller's stock. ### What is a red flag when buying peptides? A research vial described as FDA approved or as the same as a branded prescription medicine, a report that cannot be confirmed on the laboratory's own site, a batch that does not match the vial, and prices or terms given only in private chat. - [COA Reader](https://www.primaralabs.com/tools/coa-reader) - [Lab Test Planner](https://www.primaralabs.com/tools/lab-test-planner) - [Is Primara Labs legit?](https://www.primaralabs.com/answers/is-primara-labs-legit) --- URL: https://www.primaralabs.com/tools Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/tools.md # Check a report. Plan a test. Two free tools from the Primara Research Desk. Both run entirely in the browser: nothing entered is sent anywhere. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 Tools ## Tools - [COA Reader Open a laboratory's own record of a report from its task number and key, and check it against what a seller shows. Nothing entered is sent anywhere.](https://www.primaralabs.com/tools/coa-reader) - [Delivery Checker Type a city or province to see Primara Labs' delivery window, courier, fee and cutoff there, with every covered area listed.](https://www.primaralabs.com/tools/delivery-checker) - [Supplier Checklist Ten checks to apply to any peptide seller in the Philippines, each with why it matters and how to check it, and how Primara answers every one.](https://www.primaralabs.com/tools/supplier-checklist) - [Lab Test Planner Pick a compound and a question, and see which laboratory tests answer it, what they cost and what the report will and will not tell you.](https://www.primaralabs.com/tools/lab-test-planner) --- URL: https://www.primaralabs.com/calculator Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/calculator.md # Vial, diluent, syringe. The arithmetic. Milligrams divided by millilitres gives the concentration. The syringe scale turns that into what one unit holds. Everything below follows from those two facts. How the numbers are made ## Concentration Milligrams in the vial divided by millilitres of diluent added. The vial mass is fixed; the diluent volume is the one number you choose. ## Micrograms per unit A U-100 syringe divides one millilitre into 100 units, so one unit is 0.01 ml and holds the concentration in mg/ml times ten, in micrograms. A U-40 unit is 0.025 ml. ## Draws per vial The whole vial volume in units divided by the draw size you enter, rounded down to whole draws. A half-mark result is a reason to choose a different diluent volume, not to read between marks. Supplied for laboratory research use only. This page computes volumes and concentrations; it does not recommend a quantity of anything. Nothing on this site is medical advice. [Reconstitution walkthrough](https://www.primaralabs.com/blog/how-to-reconstitute-peptides)[The formulas, worked](https://www.primaralabs.com/blog/peptide-reconstitution-math)[Choosing the diluent volume](https://www.primaralabs.com/blog/how-much-bac-water-per-vial)[Syringe units explained](https://www.primaralabs.com/blog/insulin-syringe-units-explained)[Bacteriostatic water](https://www.primaralabs.com/marketplace/bac-water-3ml) --- URL: https://www.primaralabs.com/answers Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers.md # Questions buyers ask, answered first. As of 23 September 2026, Primara Labs publishes 48 answers to the questions Philippine buyers ask about research peptides: whether a compound is approved, what its trials found, what a lab test shows, and how ordering and delivery work. Each opens with a direct answer and cites the source of every figure. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 2 answers ## Trust - [Is Primara Labs legit?](https://www.primaralabs.com/answers/is-primara-labs-legit) Primara Labs is a Philippine peptide store in Makati, Metro Manila, that takes every order through WhatsApp. - [Where does Primara Labs ship from?](https://www.primaralabs.com/answers/where-does-primara-labs-ship-from) Primara Labs states that its stock is held in Metro Manila and that orders are dispatched from there, not ordered in from abroad after purchase. 5 answers ## Buying - [How do you order peptides from Primara Labs?](https://www.primaralabs.com/answers/how-do-you-order-peptides-from-primara-labs) Every Primara Labs order is placed in a WhatsApp chat; the site has no checkout. - [How much is retatrutide in the Philippines?](https://www.primaralabs.com/answers/how-much-is-retatrutide-in-the-philippines) At Primara Labs, retatrutide is ₱3,325, or ₱2,990 with 10% off for a 15mg research vial, as of 23 September 2026. - [How much is tirzepatide in the Philippines?](https://www.primaralabs.com/answers/how-much-is-tirzepatide-in-the-philippines) At Primara Labs, tirzepatide is ₱2,100, or ₱1,890 with 10% off for a 15mg research vial, as of 23 September 2026. - [Is COD available for peptide orders in Metro Manila?](https://www.primaralabs.com/answers/is-cod-available-for-peptides-in-metro-manila) Cash on delivery is available on request, subject to the conditions in our terms. - [Can peptides be delivered the same day in Metro Manila?](https://www.primaralabs.com/answers/can-peptides-be-delivered-same-day-in-metro-manila) Yes, from Primara Labs. 16 answers ## Regulation - [Is retatrutide approved in the Philippines?](https://www.primaralabs.com/answers/is-retatrutide-approved-in-the-philippines) As of 23 September 2026, retatrutide is not an approved medicine in the Philippines or anywhere else. - [When will retatrutide be approved?](https://www.primaralabs.com/answers/when-will-retatrutide-be-approved) No approval date for retatrutide exists as of 23 September 2026. - [Is tirzepatide approved in the Philippines?](https://www.primaralabs.com/answers/is-tirzepatide-approved-in-the-philippines) As of 23 September 2026, tirzepatide is approved in the United States and the European Union as branded prescription medicines. - [Is semaglutide approved in the Philippines?](https://www.primaralabs.com/answers/is-semaglutide-approved-in-the-philippines) As of 23 September 2026, semaglutide is approved in the United States and the European Union as branded prescription medicines for diabetes and weight management. - [Is BPC-157 FDA approved?](https://www.primaralabs.com/answers/is-bpc-157-fda-approved) No. - [Is TB-500 FDA approved?](https://www.primaralabs.com/answers/is-tb-500-fda-approved) No. - [Is GHK-Cu FDA approved?](https://www.primaralabs.com/answers/is-ghk-cu-fda-approved) No drug containing GHK-Cu is approved by the US FDA or the EMA as of 23 September 2026. - [Is PT-141 FDA approved?](https://www.primaralabs.com/answers/is-pt-141-fda-approved) Yes, for one named use. - [Is tesamorelin FDA approved?](https://www.primaralabs.com/answers/is-tesamorelin-fda-approved) Yes, in the United States, for one indication. - [Is NAD+ FDA approved?](https://www.primaralabs.com/answers/is-nad-plus-fda-approved) No approved drug application for NAD+ exists in Drugs@FDA as of 23 September 2026, and the EMA medicines report has no record of it either. - [Is MOTS-c FDA approved?](https://www.primaralabs.com/answers/is-mots-c-fda-approved) No. - [Are CJC-1295 and ipamorelin FDA approved?](https://www.primaralabs.com/answers/is-cjc-1295-ipamorelin-fda-approved) No. - [Is KPV approved in the Philippines?](https://www.primaralabs.com/answers/is-kpv-approved-in-the-philippines) No approval for KPV exists as of 23 September 2026. - [Which research peptides are FDA approved?](https://www.primaralabs.com/answers/which-research-peptides-are-fda-approved) Of the 16 compounds on the Primara Research Desk tracker, 4 are US FDA approved as branded medicines for named uses as of 23 September 2026: tirzepatide, semaglutide, tesamorelin, bremelanotide. - [What has FDA Philippines warned about peptides?](https://www.primaralabs.com/answers/what-has-fda-philippines-warned-about-peptides) As of 23 September 2026, FDA Philippines has published 5 public health warnings naming compounds Primara Labs tracks: unregistered tirzepatide vial products, a KPV vial and an NAD+ supplement. - [How do you check if a product is registered with FDA Philippines?](https://www.primaralabs.com/answers/how-to-check-fda-philippines-registration) FDA Philippines tells the public to check registration on its verification portal at verification.fda.gov.ph, and it keeps a separate list of health products it has found unregistered. 21 answers ## Research - [How does retatrutide work?](https://www.primaralabs.com/answers/how-does-retatrutide-work) Retatrutide is a single peptide that activates three hormone receptors at once: GIP, GLP-1 and glucagon, which its developer Eli Lilly calls a first-in-class triple agonist. - [What did the retatrutide trials find?](https://www.primaralabs.com/answers/what-did-retatrutide-trials-find) As of 23 September 2026, 5 retatrutide trials have reported. - [What are the side effects of retatrutide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-retatrutide) In TRIUMPH-1, the retatrutide phase 3 trial reported by Eli Lilly (checked 23 September 2026), nausea affected 28.6% to 42.4% of participants across the dose arms against 14.8% on placebo, and diarrhoea, constipation and vomiting were also more common. - [How does tirzepatide work?](https://www.primaralabs.com/answers/how-does-tirzepatide-work) Tirzepatide is one peptide that activates two incretin receptors, GIP and GLP-1, which is why it is called a dual agonist. - [What are the side effects of tirzepatide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-tirzepatide) In SURMOUNT-3, a phase 3 trial of tirzepatide (checked 23 September 2026), nausea was reported by 39.7% of participants against 14.0% on placebo, with diarrhoea, constipation and vomiting also more frequent. - [How does semaglutide work?](https://www.primaralabs.com/answers/how-does-semaglutide-work) Semaglutide is a modified form of the gut hormone GLP-1 that binds and activates the GLP-1 receptor, and only that receptor. - [What are the side effects of semaglutide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-semaglutide) In STEP 3, a phase 3 trial of semaglutide (checked 23 September 2026), nausea was reported by 58.2% of participants against 22.1% on placebo, and constipation, diarrhoea and vomiting were also more frequent. - [Is there human research on BPC-157?](https://www.primaralabs.com/answers/is-there-human-research-on-bpc-157) Very little. - [What are the side effects of BPC-157?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-bpc-157) The honest answer is that BPC-157's side effects in people are not known. - [What is TB-500?](https://www.primaralabs.com/answers/what-is-tb-500) TB-500 is a synthetic peptide named after thymosin beta-4, a 43-amino-acid protein that binds actin in cells. - [What does GHK-Cu do in research?](https://www.primaralabs.com/answers/what-does-ghk-cu-do-in-research) GHK-Cu is a naturally occurring tripeptide that binds copper, studied for skin and wound repair. - [What is MOTS-c studied for?](https://www.primaralabs.com/answers/what-is-mots-c-studied-for) MOTS-c is a 16-amino-acid peptide encoded in mitochondrial DNA, studied in mice and cells for insulin resistance, diet-induced obesity, physical decline with age and autoimmune diabetes. - [What does research show on NAD+ injections?](https://www.primaralabs.com/answers/what-does-research-show-on-nad-injections) As of 23 September 2026, the human research on NAD+ given by injection or infusion is small. - [What did the tesamorelin trials find?](https://www.primaralabs.com/answers/what-did-tesamorelin-trials-find) In its phase 3 trials, first reported in 2007, tesamorelin reduced visceral abdominal fat measured by CT against placebo in adults with HIV and excess abdominal fat. - [How does PT-141 work?](https://www.primaralabs.com/answers/how-does-pt-141-work) PT-141 is bremelanotide, a synthetic peptide that activates melanocortin receptors, chiefly MC3R and MC4R, in the brain rather than acting on blood vessels. - [What is CJC-1295 with ipamorelin?](https://www.primaralabs.com/answers/what-is-cjc-1295-ipamorelin) CJC-1295 with ipamorelin combines two growth hormone secretagogues: CJC-1295, an analogue of growth hormone-releasing hormone, and ipamorelin, which acts on the ghrelin receptor. - [What is semax studied for?](https://www.primaralabs.com/answers/what-is-semax-studied-for) Semax is a synthetic seven-amino-acid peptide derived from a fragment of the hormone ACTH, studied mainly in Russia for recovery after stroke and for brain function. - [What is selank studied for?](https://www.primaralabs.com/answers/what-is-selank-studied-for) Selank is a synthetic seven-amino-acid peptide studied in Russia for generalised anxiety and related conditions. - [What is DSIP studied for?](https://www.primaralabs.com/answers/what-is-dsip-studied-for) DSIP, delta sleep-inducing peptide, is a nine-amino-acid peptide first isolated from rabbit blood and later studied in people for sleep and insomnia. - [What is KPV studied for?](https://www.primaralabs.com/answers/what-is-kpv-studied-for) KPV is the last three amino acids of alpha-melanocyte-stimulating hormone, studied in mice and rats for inflammatory bowel conditions, colitis-associated tumours and chemotherapy mouth ulcers. - [Which peptides have phase 3 trials?](https://www.primaralabs.com/answers/which-peptides-have-phase-3-trials) Of the 16 compounds on the Primara Research Desk Evidence Map, 5 have at least one completed phase 3 human trial as of 23 September 2026: retatrutide, tirzepatide, semaglutide, tesamorelin, bremelanotide. 4 answers ## Testing - [What does an endotoxin result on a peptide vial mean?](https://www.primaralabs.com/answers/what-does-an-endotoxin-result-mean) An endotoxin result measures bacterial endotoxin, a fragment of bacterial cell walls, in endotoxin units (EU), usually per vial. - [What is the difference between a purity test and an identity test?](https://www.primaralabs.com/answers/purity-vs-identity-testing) An identity test checks that a vial holds the compound named on the label; a purity test, usually by HPLC, measures what share of the detected material is that compound. - [How much does it cost to test a peptide?](https://www.primaralabs.com/answers/how-much-does-it-cost-to-test-a-peptide) As of 23 September 2026, laboratory price pages list an identity and purity test on one peptide from US$200, and an endotoxin test from US$175 (the low end of a quoted range), in US dollars. - [What is a blind peptide test?](https://www.primaralabs.com/answers/what-is-a-blind-peptide-test) In a blind peptide test the laboratory is not told which compound the sample should be, and has to identify it from the data. --- URL: https://www.primaralabs.com/answers/is-primara-labs-legit Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-primara-labs-legit.md # Is Primara Labs legit? Primara Labs is a Philippine peptide store in Makati, Metro Manila, that takes every order through WhatsApp. As of 23 September 2026, it publishes a laboratory report with the laboratory's own verification key, its prices, delivery terms and a money-back guarantee, so each claim can be checked rather than taken on trust. Updated 23 September 2026 01 ## What you can check yourself The laboratory report. Retatrutide batch RETA-4728-A is Janoshik-tested for bacterial endotoxin: 6.066 EU per vial, analysed 21 September 2026 (task 234146, key H2KI86I8GWB4). This report covers bacterial endotoxin only. It does not establish identity or purity. Reports covering identity, amount and purity are published at primaralabs.com/coa per batch as they are issued. The key opens the laboratory's own record at https://verify.janoshik.com/tests/234146\_H2KI86I8GWB4, so the report can be checked without asking Primara. The prices. Every product page states its price in pesos, and every order gets 10% off, applied by hand in the WhatsApp chat. The guarantee. 60-day money-back guarantee: if an accredited independent laboratory reports that a vial is not the compound on the label, or reports purity below the certificate published for that product, the purchase price is refunded. 02 ## What Primara Labs says about itself Primara Labs is a Philippine online store for research peptides, based in Makati, Metro Manila, Philippines. Every order is placed and confirmed in a WhatsApp chat; the site has no on-site checkout. Its products are research-grade reagents for laboratory research use, not approved medicines. Primara Labs states that its stock is held in Metro Manila cold storage rather than ordered in after purchase, and it dispatches from Metro Manila. 03 ## What it does not claim Primara does not describe its vials as approved medicines, and each product page states the compound's regulatory status beside the price, read from the Research Desk dataset. It does not claim testing beyond the published report and its stated scope. The fact sheet collects these facts in one place, each generated from the file that holds it, so the same figures appear on every page. Sources ## Where every figure comes from 1. [Janoshik verification record, batch RETA-4728-A](https://verify.janoshik.com/tests/234146_H2KI86I8GWB4) · checked 23 September 2026 2. [Primara Labs fact sheet](https://www.primaralabs.com/facts) · checked 23 September 2026 3. [Primara Labs guarantee terms](https://www.primaralabs.com/guarantee) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Supplier checklist: check any seller](https://www.primaralabs.com/tools/supplier-checklist) - [The fact sheet](https://www.primaralabs.com/facts) - [What we do and don't claim](https://www.primaralabs.com/trust) - [Batch reports](https://www.primaralabs.com/coa) - [Where does Primara Labs ship from?](https://www.primaralabs.com/answers/where-does-primara-labs-ship-from) - [How do you order peptides from Primara Labs?](https://www.primaralabs.com/answers/how-do-you-order-peptides-from-primara-labs) --- URL: https://www.primaralabs.com/answers/where-does-primara-labs-ship-from Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/where-does-primara-labs-ship-from.md # Where does Primara Labs ship from? Primara Labs states that its stock is held in Metro Manila and that orders are dispatched from there, not ordered in from abroad after purchase. As of 23 September 2026, that is why Metro Manila orders placed before 12 noon on a weekday can arrive the same day, and provincial orders go by courier. Updated 23 September 2026 01 ## Where the stock is Primara Labs states that its stock is held in Metro Manila cold storage rather than ordered in after purchase, and it dispatches from Metro Manila. Primara Labs is based in Makati, Metro Manila, Philippines. 02 ## What local stock means for delivery Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Rider delivery by Grab Express or Lalamove. Courier delivery by J&T Express. 03 ## Why it matters to a buyer A parcel dispatched inside the Philippines does not pass through customs on its way to the buyer, and the delivery window is set by the local courier rather than by international shipping. Courier is free on orders over ₱10,000 anywhere in the Philippines. Below that, a Metro Manila rider is ₱150, J&T Express is ₱250 to Luzon and the Visayas and ₱300 to Mindanao. 04 ## Coverage Primara Labs delivers across the Philippines. Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Rider delivery by Grab Express or Lalamove. Courier delivery by J&T Express. The site has 45 delivery pages covering 49 named cities and provinces. Parcels for Luzon leave Metro Manila Monday to Saturday. Parcels for Visayas leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. Parcels for Mindanao leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. Sources ## Where every figure comes from 1. [Primara Labs delivery terms](https://www.primaralabs.com/delivery) · checked 23 September 2026 2. [Primara Labs fact sheet](https://www.primaralabs.com/facts#stock) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Delivery](https://www.primaralabs.com/delivery) - [Supplier checklist: check any seller](https://www.primaralabs.com/tools/supplier-checklist) - [Can peptides be delivered the same day in Metro Manila?](https://www.primaralabs.com/answers/can-peptides-be-delivered-same-day-in-metro-manila) - [Is Primara Labs legit?](https://www.primaralabs.com/answers/is-primara-labs-legit) --- URL: https://www.primaralabs.com/answers/how-do-you-order-peptides-from-primara-labs Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/how-do-you-order-peptides-from-primara-labs.md # How do you order peptides from Primara Labs? Every Primara Labs order is placed in a WhatsApp chat; the site has no checkout. As of 23 September 2026, you choose products on the site, send the prefilled message, confirm the total and delivery address in the chat, pay by a local method, and the order is dispatched from Metro Manila by rider or courier. Updated 23 September 2026 01 ## The steps Choose the products. Each product page and the cart build a WhatsApp message listing what you picked; nothing is paid on the site. Confirm in the chat. The total, including any delivery charge, is confirmed there. Every order gets 10% off, applied by hand in the WhatsApp chat. Pay. Pay by GCash, Maya or QR Ph bank transfer in the Philippines, or by Wise, Zelle, US bank transfer or crypto from abroad. Confirmed in chat. No card checkout. Cash on delivery is available on request, subject to the conditions in our terms. 02 ## Delivery Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier is free on orders over ₱10,000 anywhere in the Philippines. Below that, a Metro Manila rider is ₱150, J&T Express is ₱250 to Luzon and the Visayas and ₱300 to Mindanao. 03 ## After it arrives Every order carries the guarantee: 60-day money-back guarantee: if an accredited independent laboratory reports that a vial is not the compound on the label, or reports purity below the certificate published for that product, the purchase price is refunded. 04 ## What the message holds The prefilled WhatsApp message lists each product and quantity from the cart, so the chat starts with the order already written. Nothing is charged until the total is confirmed in the chat and paid by one of the methods above. Sources ## Where every figure comes from 1. [Primara Labs payment methods](https://www.primaralabs.com/international/payments) · checked 23 September 2026 2. [Primara Labs delivery terms](https://www.primaralabs.com/delivery) · checked 23 September 2026 3. [Primara Labs terms](https://www.primaralabs.com/terms) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Catalogue](https://www.primaralabs.com/marketplace) - [How ordering works](https://www.primaralabs.com/blog/how-ordering-works) - [Is COD available for peptide orders in Metro Manila?](https://www.primaralabs.com/answers/is-cod-available-for-peptides-in-metro-manila) - [Can peptides be delivered the same day in Metro Manila?](https://www.primaralabs.com/answers/can-peptides-be-delivered-same-day-in-metro-manila) Sa Taglish: [Paano mag-order ng peptides sa Primara Labs?](https://www.primaralabs.com/answers/tl/paano-mag-order-ng-peptides) --- URL: https://www.primaralabs.com/answers/how-much-is-retatrutide-in-the-philippines Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/how-much-is-retatrutide-in-the-philippines.md # How much is retatrutide in the Philippines? At Primara Labs, retatrutide is ₱3,325, or ₱2,990 with 10% off for a 15mg research vial, as of 23 September 2026. Packs lower the price per vial. Retatrutide is investigational and not an approved medicine anywhere, so it is sold as a research reagent, not as a prescription drug. Updated 23 September 2026 01 ## The price Single vial: ₱3,325, or ₱2,990 with 10% off. Packs: 5 vials at ₱2,228 each (₱11,140 total, 33% off), and 10 vials at ₱1,663 each (₱16,630 total, 50% off). Per milligram, that is ₱199 at the discounted single-vial price. Every order gets 10% off, applied by hand in the WhatsApp chat. 02 ## What the vial is Lyophilized powder, 15 mg / vial. Retatrutide. FDA Philippines: not established. US FDA: Investigational. Sponsor plans a US Biologics License Application submission in Q1 2027. Checked 23 September 2026. 03 ## Delivery and payment Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. Courier is free on orders over ₱10,000 anywhere in the Philippines. Below that, a Metro Manila rider is ₱150, J&T Express is ₱250 to Luzon and the Visayas and ₱300 to Mindanao. Pay by GCash, Maya or QR Ph bank transfer in the Philippines, or by Wise, Zelle, US bank transfer or crypto from abroad. Confirmed in chat. No card checkout. Cash on delivery is available on request, subject to the conditions in our terms. 04 ## Per milligram, and the guarantee At the list price that is ₱222 per milligram, and ₱199 with the standing discount. Every vial carries the guarantee: 60-day money-back guarantee: if an accredited independent laboratory reports that a vial is not the compound on the label, or reports purity below the certificate published for that product, the purchase price is refunded. 05 ## The product Triple agonist at the GLP-1, GIP and glucagon receptors. Studied in Phase 2 obesity trials. Investigational triple agonist of GLP-1, GIP and glucagon receptors under research for metabolic regulation. Sources ## Where every figure comes from 1. [Primara Labs retatrutide product page](https://www.primaralabs.com/marketplace/retatrutide) · checked 23 September 2026 2. [Primara Labs retatrutide price page](https://www.primaralabs.com/prices/retatrutide) · checked 23 September 2026 3. [Primara Research Desk, regulatory status](https://www.primaralabs.com/research/status#retatrutide) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) - [Retatrutide price page](https://www.primaralabs.com/prices/retatrutide) - [Is retatrutide approved in the Philippines?](https://www.primaralabs.com/answers/is-retatrutide-approved-in-the-philippines) - [How much is tirzepatide in the Philippines?](https://www.primaralabs.com/answers/how-much-is-tirzepatide-in-the-philippines) Sa Taglish: [Magkano ang retatrutide sa Pilipinas?](https://www.primaralabs.com/answers/tl/magkano-ang-retatrutide) --- URL: https://www.primaralabs.com/answers/how-much-is-tirzepatide-in-the-philippines Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/how-much-is-tirzepatide-in-the-philippines.md # How much is tirzepatide in the Philippines? At Primara Labs, tirzepatide is ₱2,100, or ₱1,890 with 10% off for a 15mg research vial, as of 23 September 2026. Packs lower the price per vial. The vial is a research reagent: the approved tirzepatide medicines are separate branded products sold on prescription. Updated 23 September 2026 01 ## The price Single vial: ₱2,100, or ₱1,890 with 10% off. Packs: 5 vials at ₱1,407 each (₱7,035 total, 33% off), and 10 vials at ₱1,050 each (₱10,500 total, 50% off). Per milligram, that is ₱126 at the discounted single-vial price. 02 ## The vial and the approved medicine Lyophilized powder, 15 mg / vial. Tirzepatide is the active ingredient in Mounjaro and Zepbound, prescription medicines approved by the US FDA; the Primara vial is a research-grade reagent and is not that approved product. Tirzepatide. FDA Philippines: not established. US FDA: Approved for glycemic control in type 2 diabetes mellitus (Mounjaro); weight reduction in obesity or overweight with a comorbidity and moderate to severe obstructive sleep apnea in adults with obesity (Zepbound). Checked 23 September 2026. 03 ## Ordering Every order is placed in WhatsApp and paid by GCash, Maya or QR Ph bank transfer in the Philippines. Every order gets 10% off, applied by hand in the WhatsApp chat. Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. 04 ## Per milligram, and the guarantee At the list price that is ₱140 per milligram, and ₱126 with the standing discount. Every vial carries the guarantee: 60-day money-back guarantee: if an accredited independent laboratory reports that a vial is not the compound on the label, or reports purity below the certificate published for that product, the purchase price is refunded. 05 ## The product Dual GIP and GLP-1 receptor agonist with an extensive published trial record. Dual agonist of GLP-1 and GIP receptors. Tirzepatide is the active ingredient in Mounjaro and Zepbound, prescription medicines approved by the US FDA; the Primara vial is a research-grade reagent and is not that approved product. Sources ## Where every figure comes from 1. [Primara Labs tirzepatide product page](https://www.primaralabs.com/marketplace/tirzepatide-15mg) · checked 23 September 2026 2. [Primara Labs tirzepatide price page](https://www.primaralabs.com/prices/tirzepatide) · checked 23 September 2026 3. [Primara Research Desk, regulatory status](https://www.primaralabs.com/research/status#tirzepatide) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Tirzepatide 15mg](https://www.primaralabs.com/marketplace/tirzepatide-15mg) - [Tirzepatide price page](https://www.primaralabs.com/prices/tirzepatide) - [Is tirzepatide approved in the Philippines?](https://www.primaralabs.com/answers/is-tirzepatide-approved-in-the-philippines) - [How much is retatrutide in the Philippines?](https://www.primaralabs.com/answers/how-much-is-retatrutide-in-the-philippines) Sa Taglish: [Magkano ang tirzepatide sa Pilipinas?](https://www.primaralabs.com/answers/tl/magkano-ang-tirzepatide) --- URL: https://www.primaralabs.com/answers/is-cod-available-for-peptides-in-metro-manila Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-cod-available-for-peptides-in-metro-manila.md # Is COD available for peptide orders in Metro Manila? Cash on delivery is available on request, subject to the conditions in our terms. That is Primara Labs' position as of 23 September 2026. Most orders are paid before dispatch by GCash, Maya or QR Ph bank transfer, and Metro Manila orders confirmed before 12 noon on a weekday go out by rider the same day. Updated 23 September 2026 01 ## COD, and where its conditions are The one-line policy above is all the site states about it outside the terms. The conditions, including the deposit and what happens to a parcel that is refused, are set out in full in the terms, in the section on paying at delivery, and are agreed in the WhatsApp chat before dispatch. 02 ## Every payment method Pay by GCash, Maya or QR Ph bank transfer in the Philippines, or by Wise, Zelle, US bank transfer or crypto from abroad. Confirmed in chat. No card checkout. Cash on delivery is available on request, subject to the conditions in our terms. 03 ## Delivery in Metro Manila Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. Rider delivery by Grab Express or Lalamove. Courier is free on orders over ₱10,000 anywhere in the Philippines. Below that, a Metro Manila rider is ₱150, J&T Express is ₱250 to Luzon and the Visayas and ₱300 to Mindanao. Areas served same day include Makati, Bonifacio Global City, Quezon City, Ortigas, Pasig, Mandaluyong, Manila, Alabang. 04 ## Paying before dispatch Most orders are paid before dispatch by GCash, Maya or QR Ph bank transfer, after the total is confirmed in the WhatsApp chat. Every order gets 10% off, applied by hand in the WhatsApp chat. Whichever way an order is paid, it carries the guarantee: 60-day money-back guarantee: if an accredited independent laboratory reports that a vial is not the compound on the label, or reports purity below the certificate published for that product, the purchase price is refunded. Sources ## Where every figure comes from 1. [Primara Labs terms, COD section](https://www.primaralabs.com/terms#cod) · checked 23 September 2026 2. [Primara Labs payment methods](https://www.primaralabs.com/international/payments) · checked 23 September 2026 3. [Primara Labs delivery terms](https://www.primaralabs.com/delivery) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Terms](https://www.primaralabs.com/terms#cod) - [Delivery](https://www.primaralabs.com/delivery) - [How do you order peptides from Primara Labs?](https://www.primaralabs.com/answers/how-do-you-order-peptides-from-primara-labs) - [Can peptides be delivered the same day in Metro Manila?](https://www.primaralabs.com/answers/can-peptides-be-delivered-same-day-in-metro-manila) Sa Taglish: [May COD ba para sa peptides sa Metro Manila?](https://www.primaralabs.com/answers/tl/may-cod-ba-sa-peptides) --- URL: https://www.primaralabs.com/answers/can-peptides-be-delivered-same-day-in-metro-manila Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/can-peptides-be-delivered-same-day-in-metro-manila.md # Can peptides be delivered the same day in Metro Manila? Yes, from Primara Labs. As of 23 September 2026, a Metro Manila order confirmed before 12 noon on a weekday arrives the same day by rider, because the stock is already in Metro Manila. Elsewhere, courier delivery takes Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. Updated 23 September 2026 01 ## The same-day promise Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. Rider delivery by Grab Express or Lalamove. Same-day areas include Makati, Bonifacio Global City, Quezon City, Ortigas, Pasig, Mandaluyong, Manila, Alabang, Muntinlupa, Parañaque, Pasay, Taguig, San Juan, Marikina, Las Piñas, Caloocan. 02 ## What it costs Courier is free on orders over ₱10,000 anywhere in the Philippines. Below that, a Metro Manila rider is ₱150, J&T Express is ₱250 to Luzon and the Visayas and ₱300 to Mindanao. 03 ## Outside Metro Manila Luzon lands in 1 to 2 business days by J&T Express, the Visayas in 2 to 3 business days and Mindanao in 3 to 5 business days. Courier delivery by J&T Express. Each region's page on the site lists the cities and provinces it covers, with its own window where a city differs from its region. 04 ## Region by region Metro Manila: same day before 12 noon, by Grab Express / Lalamove. Luzon: 1 to 2 business days, by J&T Express. Parcels for Luzon leave Metro Manila Monday to Saturday. Visayas: 2 to 3 business days, by J&T Express. Parcels for Visayas leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. Mindanao: 3 to 5 business days, by J&T Express. Parcels for Mindanao leave Metro Manila Monday to Wednesday only, so a vial is never sitting in a courier hub over a weekend. 05 ## Why same day is possible Primara Labs states that its stock is held in Metro Manila cold storage rather than ordered in after purchase, and it dispatches from Metro Manila. Sources ## Where every figure comes from 1. [Primara Labs delivery terms](https://www.primaralabs.com/delivery) · checked 23 September 2026 2. [Primara Labs delivery areas](https://www.primaralabs.com/buy-peptides) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Delivery](https://www.primaralabs.com/delivery) - [Delivery areas](https://www.primaralabs.com/buy-peptides) - [Where does Primara Labs ship from?](https://www.primaralabs.com/answers/where-does-primara-labs-ship-from) - [Is COD available for peptide orders in Metro Manila?](https://www.primaralabs.com/answers/is-cod-available-for-peptides-in-metro-manila) Sa Taglish: [Pwede bang same day ang delivery ng peptides sa Metro Manila?](https://www.primaralabs.com/answers/tl/same-day-delivery-ng-peptides) --- URL: https://www.primaralabs.com/answers/is-retatrutide-approved-in-the-philippines Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-retatrutide-approved-in-the-philippines.md # Is retatrutide approved in the Philippines? As of 23 September 2026, retatrutide is not an approved medicine in the Philippines or anywhere else. Its developer, Eli Lilly, describes it as investigational and plans a US Biologics License Application submission in Q1 2027. No FDA Philippines advisory names retatrutide, and its registration record could not be read that day. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## Where retatrutide stands with each regulator United States: "Investigational". Eli Lilly's release of 23 July 2026 describes retatrutide as investigational. Drugs@FDA returned no approved application. European Union: "No record found". No row for this substance in the EMA medicines report generated 22 September 2026. That report does not cover national authorisations in EU member states. Philippines: not established. Could not be established: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. A search of fda.gov.ph for "retatrutide" on 23 September 2026 returned no advisory. 02 ## What comes next Sponsor plans a US Biologics License Application submission in Q1 2027 (Eli Lilly press release dated 23 July 2026). 5 completed trials of retatrutide are on the Primara Research Desk, and 6 phase 3 trials (TRIUMPH-5, TRIUMPH-6, TRIUMPH-7, TRIUMPH-8, TRIUMPH-9, TRIUMPH-OUTCOMES) are still running without published results. A US filing is a request for approval, not an approval. Any approval would cover a named, branded medicine for a named indication, and a registration in the Philippines would be a separate application to FDA Philippines. 03 ## What this means for a research vial Retatrutide sold as a research reagent is not a registered medicine and is not presented as one. Primara Labs sells it for laboratory research use and states its investigational status beside the price on its product page, read from the same regulatory dataset as this answer. 04 ## Checking an approval claim A claim that retatrutide is "approved" or "FDA registered" should come with an application or registration number that can be looked up. As of 23 September 2026, the Regulatory Status Tracker records no such number with the US FDA, the EMA or FDA Philippines. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for Retatrutide](https://lilly.mediaroom.com/2026-07-23-Lillys-triple-agonist,-retatrutide,-successful-in-two-additional-Phase-3-obesity-trials,-delivering-significant-improvements-in-weight-and-A1C) · checked 23 September 2026 2. [EMA record for Retatrutide](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 3. [Sponsor statement](https://lilly.mediaroom.com/2026-07-23-Lillys-triple-agonist,-retatrutide,-successful-in-two-additional-Phase-3-obesity-trials,-delivering-significant-improvements-in-weight-and-A1C) · checked 23 September 2026 4. [FDA Philippines site search, retatrutide](https://www.fda.gov.ph/?s=retatrutide) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) - [Regulatory Status Tracker: retatrutide](https://www.primaralabs.com/research/status#retatrutide) - [Retatrutide trials on the Research Desk](https://www.primaralabs.com/research/trials) - [When will retatrutide be approved?](https://www.primaralabs.com/answers/when-will-retatrutide-be-approved) - [Is tirzepatide approved in the Philippines?](https://www.primaralabs.com/answers/is-tirzepatide-approved-in-the-philippines) --- URL: https://www.primaralabs.com/answers/when-will-retatrutide-be-approved Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/when-will-retatrutide-be-approved.md # When will retatrutide be approved? No approval date for retatrutide exists as of 23 September 2026. Eli Lilly said in its release of 23 July 2026 that it plans a US Biologics License Application submission in Q1 2027. The FDA then reviews the file, so any approval would come after that, and Philippine registration would need a separate application. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The sponsor's stated plan The regulatory dataset records the next milestone as: "Sponsor plans a US Biologics License Application submission in Q1 2027". The source is Eli Lilly press release dated 23 July 2026, read on 23 September 2026. A Biologics License Application is the file a sponsor submits to ask the US FDA for approval. Submission starts a review; it does not grant anything, and the review can end in approval, a request for more data, or refusal. 02 ## Trials that have reported and trials still running 5 completed retatrutide trials are on the Research Desk: TRIUMPH-1, TRIUMPH-2, TRIUMPH-3, TRIUMPH-4, Retatrutide phase 2 (Jastreboff). Their results are summarised, with adverse events, on the Trial Explorer. 6 phase 3 trials are listed as ongoing on ClinicalTrials.gov: TRIUMPH-5 (NCT06662383), TRIUMPH-6 (NCT06859268), TRIUMPH-7 (NCT07035093), TRIUMPH-8 (NCT07232719), TRIUMPH-9 (NCT07357415), TRIUMPH-OUTCOMES (NCT06383390). None has published results. 03 ## The Philippines An approval in the United States would not register retatrutide in the Philippines. Registration is a separate application to FDA Philippines, and its current record for retatrutide could not be read: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. 04 ## How to follow it A filing, a regulatory decision and a Philippine registration are three separate events, and each will be recorded with its own date on the Regulatory Status Tracker when it happens. The Trial Explorer adds each running TRIUMPH trial's results once the sponsor or the trial paper publishes them, with the adverse events beside the outcome. This is general information, not legal advice. Sources ## Where every figure comes from 1. [Eli Lilly press release, 23 July 2026](https://lilly.mediaroom.com/2026-07-23-Lillys-triple-agonist,-retatrutide,-successful-in-two-additional-Phase-3-obesity-trials,-delivering-significant-improvements-in-weight-and-A1C) · checked 23 September 2026 2. [ClinicalTrials.gov NCT06662383](https://clinicaltrials.gov/study/NCT06662383) · checked 23 September 2026 3. [ClinicalTrials.gov NCT06859268](https://clinicaltrials.gov/study/NCT06859268) · checked 23 September 2026 4. [ClinicalTrials.gov NCT07035093](https://clinicaltrials.gov/study/NCT07035093) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) - [Trial Explorer: retatrutide](https://www.primaralabs.com/research/trials) - [Regulatory Status Tracker](https://www.primaralabs.com/research/status#retatrutide) - [Is retatrutide approved in the Philippines?](https://www.primaralabs.com/answers/is-retatrutide-approved-in-the-philippines) - [What did the retatrutide trials find?](https://www.primaralabs.com/answers/what-did-retatrutide-trials-find) --- URL: https://www.primaralabs.com/answers/is-tirzepatide-approved-in-the-philippines Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-tirzepatide-approved-in-the-philippines.md # Is tirzepatide approved in the Philippines? As of 23 September 2026, tirzepatide is approved in the United States and the European Union as branded prescription medicines. Its Philippine registration record could not be read that day, but FDA Philippines lists tirzepatide injections as VAT-exempt diabetes medicines and has warned against 3 unregistered tirzepatide vial products. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## United States and European Union US FDA: "Approved for glycemic control in type 2 diabetes mellitus (Mounjaro); weight reduction in obesity or overweight with a comorbidity and moderate to severe obstructive sleep apnea in adults with obesity (Zepbound)". Drugs@FDA records Mounjaro (NDA215866, approved 13 May 2022); Zepbound (NDA217806, approved 8 November 2023). The approval covers those branded medicines for their labelled uses only. EMA: "Approved for type 2 diabetes mellitus and weight management (Mounjaro)". Mounjaro, EMEA/H/C/005620, authorised 15 September 2022. 02 ## What FDA Philippines has published FDA Advisory No. 2026-0596, 4 May 2026: FDA Philippines published updates to its list of VAT-exempt drugs and medicines under the CREATE Act, listing tirzepatide solutions for subcutaneous injection under medicines for diabetes. FDA Advisory No. 2026-0065, 6 February 2026: FDA Philippines published updates to its list of VAT-exempt health products under the CREATE Act, listing tirzepatide solutions for subcutaneous injection among drugs for diabetes. FDA Advisory No. 2026-1020, 4 September 2026: FDA Philippines warned the public against buying or using an unregistered tirzepatide 30mg multi-use vial sold with bacteriostatic water, which had not been issued a Certificate of Product Registration. FDA Advisory No. 2026-1019, 4 September 2026: FDA Philippines warned the public against buying or using an unregistered tirzepatide product sold as Peptatide Tirzepatide 15mg with a bacteriostatic water kit, which had not been issued a Certificate of Product Registration. FDA Advisory No. 2026-0814, 30 July 2026: FDA Philippines warned the public against buying or using an unregistered tirzepatide product sold as Tirz Laine Tirzepatide 30mg/3 mL, which had not been issued a Certificate of Product Registration. 03 ## What the advisories do and do not establish The warnings concern specific unregistered products, each named in the advisory; they do not say whether any tirzepatide medicine holds a Philippine registration. The VAT-exempt lists name tirzepatide injections by strength and form without naming a brand or stating registration. The registration record itself could not be read: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for Tirzepatide](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=215866) · checked 23 September 2026 2. [EMA record for Tirzepatide](https://www.ema.europa.eu/en/medicines/human/EPAR/mounjaro) · checked 23 September 2026 3. [FDA Philippines Advisory 2026-1020](https://www.fda.gov.ph/fda-advisory-no-2026-1020-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-tirzepatide-subcutaneously-use-only-30mg-multi-use-vial-and-bac-water-0-9-benz/) · checked 23 September 2026 4. [FDA Philippines Advisory 2026-1019](https://www.fda.gov.ph/fda-advisory-no-2026-1019-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-peptatide-tirzepatide-for-subcutaneously-use-only-15mg-and-peptatide-bacterios/) · checked 23 September 2026 5. [FDA Philippines Advisory 2026-0814](https://www.fda.gov.ph/fda-advisory-no-2026-0814-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-tirz-laine-tirzepatide-30mg-3-ml-99-purity/) · checked 23 September 2026 6. [FDA Philippines Advisory 2026-0596](https://www.fda.gov.ph/fda-advisory-no-2026-0596-endorsement-of-updates-on-the-list-of-vat-exempt-drugs-and-medicines/) · checked 23 September 2026 7. [FDA Philippines Advisory 2026-0065](https://www.fda.gov.ph/fda-advisory-no-2026-0065-endorsement-of-updates-on-the-list-of-vat-exempt-health-products/) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Tirzepatide 15mg](https://www.primaralabs.com/marketplace/tirzepatide-15mg) - [Regulatory Status Tracker: tirzepatide](https://www.primaralabs.com/research/status#tirzepatide) - [FDA Philippines advisories dataset](https://www.primaralabs.com/research/status) - [What has FDA Philippines warned about peptides?](https://www.primaralabs.com/answers/what-has-fda-philippines-warned-about-peptides) - [Is semaglutide approved in the Philippines?](https://www.primaralabs.com/answers/is-semaglutide-approved-in-the-philippines) --- URL: https://www.primaralabs.com/answers/is-semaglutide-approved-in-the-philippines Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-semaglutide-approved-in-the-philippines.md # Is semaglutide approved in the Philippines? As of 23 September 2026, semaglutide is approved in the United States and the European Union as branded prescription medicines for diabetes and weight management. FDA Philippines lists semaglutide injections among VAT-exempt diabetes medicines; the registration record itself could not be read from its verification portal that day. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## United States US FDA: "Approved for glycemic control in type 2 diabetes mellitus and related cardiovascular and kidney risk reduction (Ozempic, Rybelsus); chronic weight management and cardiovascular risk reduction in obesity or overweight (Wegovy)". Drugs@FDA records Ozempic (NDA209637, approved 5 December 2017); WEGOVY (injection) (NDA215256, approved 4 June 2021); RYBELSUS / OZEMPIC (tablets) (NDA213051, approved 20 September 2019); Rybelsus (NDA213182, approved 16 January 2020); WEGOVY (tablets) (NDA218316, approved 22 December 2025). Each approval covers the named branded product, its formulation and its labelled use. It does not extend to any other product containing semaglutide. 02 ## European Union EMA: "Approved for type 2 diabetes mellitus (Ozempic, Rybelsus), weight management (Wegovy) and non-cirrhotic MASH with F2 to F3 fibrosis (Kayshild)". Five authorised products containing semaglutide, all held by Novo Nordisk A/S. The authorisation covers the named medicines only. 03 ## Philippines FDA Advisory No. 2025-1200, 6 November 2025: FDA Philippines published updates to its list of VAT-exempt health products under the CREATE Act, including seven semaglutide solutions for injection listed under drugs for diabetes. No FDA Philippines advisory found on 23 September 2026 warns against a semaglutide product, unlike tirzepatide. The registration record could not be read: the FDA Philippines verification portal search timed out on 23 September 2026, retried the same day in a browser with the same result. 04 ## What the approvals do not cover A research-grade vial containing semaglutide is none of these medicines. It has no approved label, no approved device and no approved indication, and the approvals above, in any country, do not extend to it. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for Semaglutide](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=209637) · checked 23 September 2026 2. [EMA record for Semaglutide](https://www.ema.europa.eu/en/medicines/human/EPAR/ozempic) · checked 23 September 2026 3. [FDA Philippines Advisory 2025-1200](https://www.fda.gov.ph/fda-advisory-no-2025-1200-endorsement-of-updates-on-the-list-of-vat-exempt-health-products/) · checked 23 September 2026 4. [FDA Philippines site search, semaglutide](https://www.fda.gov.ph/?s=semaglutide) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) - [Regulatory Status Tracker: semaglutide](https://www.primaralabs.com/research/status#semaglutide) - [Is tirzepatide approved in the Philippines?](https://www.primaralabs.com/answers/is-tirzepatide-approved-in-the-philippines) - [Which research peptides are FDA approved?](https://www.primaralabs.com/answers/which-research-peptides-are-fda-approved) --- URL: https://www.primaralabs.com/answers/is-bpc-157-fda-approved Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-bpc-157-fda-approved.md # Is BPC-157 FDA approved? No. As of 23 September 2026, the US FDA's Drugs@FDA database holds no approved application for BPC-157, and the EMA has no record of it. FDA lists BPC-157 among bulk substances that may present significant safety risks in compounding. No FDA Philippines advisory names it. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The records searched US FDA: "No record found". Drugs@FDA covers approved and tentatively approved applications, so an investigational use would not appear there. EMA: "No record found" in its medicines report, which covers centrally authorised medicines and not national ones. 02 ## FDA's compounding list On its page of bulk drug substances that may present significant safety risks in compounding (current as of 22 April 2026), FDA says of BPC-157: "Compounded drugs containing BPC-157 may pose risk for immunogenicity for certain routes of administration and may have complexities with regard to peptide-related impurities and active pharmaceutical ingredient (API) characterization. FDA has identified no, or only limited, safety-related information for the proposed routes of administration. Therefore, the agency lacks sufficient information to know whether the drug would cause harm when administered to humans." That page is about compounding pharmacies in the United States. It is not an approval decision, and it is quoted here for what it says about the evidence behind the substance. 03 ## Evidence and the Philippines The Research Desk rates BPC-157's strongest evidence as small human studies: tendon, ligament and muscle healing and gastrointestinal injury in rats; interstitial cystitis and knee pain in small uncontrolled human reports. In the Philippines, a search of fda.gov.ph for "BPC-157" on 23 September 2026 returned no advisory, and the registration record could not be read from the verification portal. 04 ## What approval would take A drug approval starts with a sponsor running controlled human trials and filing them with a regulator. The regulatory dataset records no sponsor for BPC-157 in any record read on 23 September 2026, and the Research Desk found no randomised controlled human trial of it. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for BPC-157](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22BPC-157%22&limit=10) · checked 23 September 2026 2. [EMA record for BPC-157](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 3. [FDA, bulk drug substances that may present significant safety risks in compounding](https://www.fda.gov/drugs/human-drug-compounding/certain-bulk-drug-substances-use-compounding-may-present-significant-safety-risks) · checked 23 September 2026 4. [FDA Philippines site search, BPC-157](https://www.fda.gov.ph/?s=BPC-157) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [BPC-157 20mg](https://www.primaralabs.com/marketplace/bpc-157-20mg) - [Evidence Map: BPC-157](https://www.primaralabs.com/research/evidence#bpc-157) - [Regulatory Status Tracker: BPC-157](https://www.primaralabs.com/research/status#bpc-157) - [Is there human research on BPC-157?](https://www.primaralabs.com/answers/is-there-human-research-on-bpc-157) - [Which research peptides are FDA approved?](https://www.primaralabs.com/answers/which-research-peptides-are-fda-approved) --- URL: https://www.primaralabs.com/answers/is-tb-500-fda-approved Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-tb-500-fda-approved.md # Is TB-500 FDA approved? No. As of 23 September 2026, neither the US FDA nor the EMA holds a record of an approved TB-500 medicine. FDA names the thymosin beta-4 fragment LKKTETQ, also known as TB-500, on its compounding safety-risk list and says it has identified no human exposure data. No FDA Philippines advisory names it. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## What FDA wrote about TB-500 FDA's compounding page (current as of 22 April 2026) lists "Thymosin beta-4, fragment (LKKTETQ), also known as TB-500" and says: "Compounded drugs containing thymosin Beta-4, Fragment (LKKTETQ) may pose risk for immunogenicity for certain routes of administration due to the potential for aggregation as well as peptide-related impurities. FDA has not identified any human exposure data drug products containing Thymosin Beta-4, Fragment." Drugs@FDA holds "no record found" for thymosin beta-4, its fragment or TB-500, and the EMA medicines report holds "no record found". 02 ## A naming problem worth knowing TB-500 is not the same molecule as full-length thymosin beta-4. Human trials, including eye-drop studies, used the 43-amino-acid protein, while the analytical literature identifies TB-500 as a short acetylated fragment. The Research Desk therefore rates TB-500's evidence as animal and cell, and the full-length protein's human work does not transfer to it. 03 ## Philippines Searches of fda.gov.ph for "TB-500" and "thymosin" on 23 September 2026 returned no advisory. The registration record could not be read from the FDA Philippines verification portal that day. 04 ## The animal work In aged and diabetic mice, the seven-amino-acid thymosin beta-4 fragment LKKTETQ promoted skin wound repair about as well as the full-length protein. Animal and cell studies only for TB-500. Human trials exist for full-length thymosin beta-4, a different molecule, mostly as eye drops; see the Evidence Map. 05 ## A cell study on the molecule itself In a cell scratch-wound test, the TB-500 breakdown product Ac-LKKTE showed wound-healing activity, while TB-500 itself did not. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for TB-500](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22thymosin%20beta-4%22&limit=10) · checked 23 September 2026 2. [EMA record for TB-500](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 3. [FDA, bulk drug substances that may present significant safety risks in compounding](https://www.fda.gov/drugs/human-drug-compounding/certain-bulk-drug-substances-use-compounding-may-present-significant-safety-risks) · checked 23 September 2026 4. [FDA Philippines site search, TB-500](https://www.fda.gov.ph/?s=TB-500) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [TB-500 10mg](https://www.primaralabs.com/marketplace/tb-500-10mg) - [Evidence Map: TB-500](https://www.primaralabs.com/research/evidence#tb-500) - [Regulatory Status Tracker: TB-500](https://www.primaralabs.com/research/status#tb-500) - [What is TB-500?](https://www.primaralabs.com/answers/what-is-tb-500) - [Is BPC-157 FDA approved?](https://www.primaralabs.com/answers/is-bpc-157-fda-approved) --- URL: https://www.primaralabs.com/answers/is-ghk-cu-fda-approved Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-ghk-cu-fda-approved.md # Is GHK-Cu FDA approved? No drug containing GHK-Cu is approved by the US FDA or the EMA as of 23 September 2026. FDA lists GHK-Cu for injectable routes among compounding substances that may present significant safety risks, noting limited human safety data. Copper peptides also appear in cosmetics, which is a separate category from drug approval. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The drug records US FDA: "No record found" for GHK-Cu or copper peptide in Drugs@FDA. EMA: "No record found". Neither database lists cosmetic ingredients, so the absence speaks to drug approval only. 02 ## FDA on injectable GHK-Cu The compounding page (current as of 22 April 2026) lists "GHK-Cu (for injectable routes of administration)" and states: "Compounded injectable drugs containing GHK-Cu may pose risk for immunogenicity due to the potential for aggregation and peptide-related impurities. There are limited data in humans to inform safety-related considerations." The listing is limited to injectable routes. It says nothing about topical cosmetic products, which are regulated differently. 03 ## Research and the Philippines On the Research Desk GHK-Cu's strongest evidence is small human studies, from small topical trials on diabetic foot ulcers and skin after laser resurfacing. A search of fda.gov.ph for "GHK" on 23 September 2026 returned only an unrelated cosmetic brand advisory, and the registration record could not be read from the verification portal. 04 ## The human trials that exist In a randomised, evaluator-blinded, placebo-controlled trial of a GHK-Cu gel on diabetic foot ulcers, median ulcer closure was 98.5% with the gel against 60.8% with the inactive gel; the abstract does not state the trial's size or phase. Both human trials applied GHK-Cu to the skin. No published trial has given it by injection, which is the route FDA's safety-risk listing covers. 05 ## A null result In 13 randomised patients after laser skin resurfacing, GHK-Cu skin care made no measurable difference to redness, wrinkles or blinded ratings, though patients rated their skin quality higher. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for GHK-Cu](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22GHK-Cu%22&limit=10) · checked 23 September 2026 2. [EMA record for GHK-Cu](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 3. [FDA, bulk drug substances that may present significant safety risks in compounding](https://www.fda.gov/drugs/human-drug-compounding/certain-bulk-drug-substances-use-compounding-may-present-significant-safety-risks) · checked 23 September 2026 4. [FDA Philippines site search, GHK](https://www.fda.gov.ph/?s=GHK) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [GHK-Cu 50mg](https://www.primaralabs.com/marketplace/ghk-cu-50mg) - [Evidence Map: GHK-Cu](https://www.primaralabs.com/research/evidence#ghk-cu) - [Regulatory Status Tracker: GHK-Cu](https://www.primaralabs.com/research/status#ghk-cu) - [What does GHK-Cu do in research?](https://www.primaralabs.com/answers/what-does-ghk-cu-do-in-research) - [Is BPC-157 FDA approved?](https://www.primaralabs.com/answers/is-bpc-157-fda-approved) --- URL: https://www.primaralabs.com/answers/is-pt-141-fda-approved Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-pt-141-fda-approved.md # Is PT-141 FDA approved? Yes, for one named use. As of 23 September 2026, bremelanotide, the compound called PT-141, is US FDA approved as a branded injection for acquired, generalized hypoactive sexual desire disorder in premenopausal women. The EMA has no record of it, and its Philippine registration could not be read. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The US approval US FDA: "Approved for acquired, generalized hypoactive sexual desire disorder (HSDD) in premenopausal women". Drugs@FDA records Vyleesi (NDA210557, approved 21 June 2019). The label limits the indication: it is not indicated for postmenopausal women or for men, and not to enhance sexual performance. The approval covers that branded medicine only. 02 ## Europe and the Philippines EMA: "No record found" for bremelanotide or its US brand in the EMA medicines report, which covers central authorisations only. Searches of fda.gov.ph for "bremelanotide" and "PT-141" on 23 September 2026 returned no advisory, and the registration record could not be read from the verification portal. 03 ## The evidence behind the approval The Research Desk rates bremelanotide's evidence as phase 3 human, from the two 24-week RECONNECT phase 3 trials in premenopausal women. Those trials and their adverse events are summarised on the Trial Explorer. 04 ## What the trials found, and the side effects In RECONNECT (studies 301 and 302), a phase 3 trial of bremelanotide in premenopausal women with hypoactive sexual desire disorder (n=1,267), the FSFI desire domain score difference from placebo was +0.30 points on study 301, 1.75 mg and +0.42 points on study 302, 1.75 mg over 24 weeks (Kingsberg SA et al. Obstet Gynecol 2019 (RECONNECT)). Across the development programme, focal skin darkening was rare at labelled use but occurred in more than a third of people given up to 16 consecutive daily doses, and small, transient blood pressure rises were seen on ambulatory monitoring. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for Bremelanotide](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=210557) · checked 23 September 2026 2. [EMA record for Bremelanotide](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 3. [FDA Philippines site search, bremelanotide](https://www.fda.gov.ph/?s=bremelanotide) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [PT-141 10mg](https://www.primaralabs.com/marketplace/pt-141-10mg) - [RECONNECT on the Trial Explorer](https://www.primaralabs.com/research/trials/reconnect) - [Regulatory Status Tracker: bremelanotide](https://www.primaralabs.com/research/status#bremelanotide) - [How does PT-141 work?](https://www.primaralabs.com/answers/how-does-pt-141-work) - [Which research peptides are FDA approved?](https://www.primaralabs.com/answers/which-research-peptides-are-fda-approved) --- URL: https://www.primaralabs.com/answers/is-tesamorelin-fda-approved Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-tesamorelin-fda-approved.md # Is tesamorelin FDA approved? Yes, in the United States, for one indication. As of 23 September 2026, tesamorelin is US FDA approved as a branded medicine to reduce excess abdominal fat in adults with HIV and lipodystrophy. In the European Union it is not approved: the application was withdrawn in 2012. Its Philippine registration could not be read. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## United States US FDA: "Approved for reduction of excess abdominal fat in HIV-infected adult patients with lipodystrophy". Drugs@FDA records Egrifta (BLA022505, approved 10 November 2010). The label also states that it is not indicated for weight loss management. 02 ## European Union EMA: "Not approved". The application for Egrifta (EMEA/H/C/002427) was withdrawn on 21 June 2012; no marketing authorisation was granted. 03 ## Philippines and the evidence A search of fda.gov.ph for "tesamorelin" on 23 September 2026 returned no advisory, and the registration record could not be read from the verification portal. The Research Desk rates tesamorelin's evidence as phase 3 human, from phase 3 trials in adults with HIV and excess visceral fat; the results and adverse events are on the Trial Explorer. 04 ## The trial behind the approval In Tesamorelin phase 3 (Falutz, NEJM 2007), a phase 3 trial of tesamorelin in adults with HIV and abdominal fat accumulation (86% men) (n=412), the visceral adipose tissue was -15.2% on 2 mg over 26 weeks, against +5.0% on placebo (Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3)). In a 12-month randomised, placebo-controlled trial of 61 people with HIV and fatty liver disease, with no phase stated, tesamorelin reduced liver fat fraction by an absolute 4.1 percentage points more than placebo. 05 ## Side effects reported In a 20-week phase 2 trial in older adults, mild adverse events were reported by 68% on tesamorelin against 36% on placebo. In a 6-month trial of 50 people with HIV, fasting glucose rose 9 mg per decilitre on tesamorelin against 2 on placebo at 2 weeks; the difference was not significant at 6 months. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for Tesamorelin](https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=022505) · checked 23 September 2026 2. [EMA record for Tesamorelin](https://www.ema.europa.eu/en/medicines/human/EPAR/egrifta) · checked 23 September 2026 3. [FDA Philippines site search, tesamorelin](https://www.fda.gov.ph/?s=tesamorelin) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Tesamorelin 10mg](https://www.primaralabs.com/marketplace/tesamorelin-10mg) - [Tesamorelin phase 3 on the Trial Explorer](https://www.primaralabs.com/research/trials/tesamorelin-phase-3-2007) - [Regulatory Status Tracker: tesamorelin](https://www.primaralabs.com/research/status#tesamorelin) - [What did the tesamorelin trials find?](https://www.primaralabs.com/answers/what-did-tesamorelin-trials-find) - [Which research peptides are FDA approved?](https://www.primaralabs.com/answers/which-research-peptides-are-fda-approved) --- URL: https://www.primaralabs.com/answers/is-nad-plus-fda-approved Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-nad-plus-fda-approved.md # Is NAD+ FDA approved? No approved drug application for NAD+ exists in Drugs@FDA as of 23 September 2026, and the EMA medicines report has no record of it either. FDA Philippines has warned against one unregistered NAD+ food supplement. The drug record searches do not cover dietary supplements, which follow different rules. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The drug databases US FDA: "No record found" for NAD, nicotinamide adenine dinucleotide or nadide in Drugs@FDA. EMA: "No record found". NAD+ is not on FDA's compounding safety-risk list. 02 ## FDA Philippines FDA Advisory No. 2025-0084, 30 January 2025: FDA Philippines warned the public against buying or consuming an unregistered liposomal NAD+ food supplement in capsules, for which no Certificate of Product Registration had been issued. That advisory concerns one named oral supplement. It does not rule on injectable NAD+ or on any other product, and the verification portal could not be read to check registrations. 03 ## Where the research stands The Research Desk rates NAD+ at small human studies. The human work is small: an intravenous trial in ischaemic heart failure and short studies of blood NAD levels in healthy adults, with animal studies of heart and brain injury behind them. 04 ## The human trial, and what was reported In a single-centre randomised trial of 180 adults with heart failure from ischaemic heart disease, with no phase stated, ejection fraction at one month was 45.44% on NAD+ against 42.44% on placebo; differences in clinical events were not statistically significant. In the 180-person heart-failure trial, one of 90 on NAD+ reported minor dizziness. In a retrospective review at a commercial clinic, all 6 people given intravenous NAD+ reported stomach cramping, diarrhoea, nausea, vomiting, a faster heart rate or chest pressure during the infusion. 05 ## Blood levels In a phase 0/1b randomised trial in healthy adults aged 45 to 75, an oral NAD+ formulation raised whole-blood NAD inside cells by 53% against placebo after five days; no clinical endpoint held up after correction for multiple testing. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for NAD+](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22NAD%22&limit=10) · checked 23 September 2026 2. [EMA record for NAD+](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 3. [FDA Philippines Advisory 2025-0084](https://www.fda.gov.ph/fda-advisory-no-2025-0084-public-health-warning-against-the-purchase-and-consumption-of-the-unregistered-food-supplement-fulimiks-liposomal-nad-dietary-supplement-120-capsules/) · checked 23 September 2026 4. [FDA Philippines site search, NAD+](https://www.fda.gov.ph/?s=NAD%2B) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [NAD+ 1000mg](https://www.primaralabs.com/marketplace/nad-1000mg) - [Evidence Map: NAD+](https://www.primaralabs.com/research/evidence#nad) - [Regulatory Status Tracker: NAD+](https://www.primaralabs.com/research/status#nad) - [What does research show on NAD+ injections?](https://www.primaralabs.com/answers/what-does-research-show-on-nad-injections) - [Which research peptides are FDA approved?](https://www.primaralabs.com/answers/which-research-peptides-are-fda-approved) --- URL: https://www.primaralabs.com/answers/is-mots-c-fda-approved Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-mots-c-fda-approved.md # Is MOTS-c FDA approved? No. As of 23 September 2026, MOTS-c has no approved application with the US FDA and no record with the EMA. FDA lists it among compounding substances that may present significant safety risks and says it has not identified human exposure data by any route. No FDA Philippines advisory names MOTS-c. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## FDA's statement From FDA's compounding page, current as of 22 April 2026: "Compounded drugs containing MOTs-C may pose significant risk for immunogenicity for certain routes of administration and may have complexities with regard to peptide-related impurities and API characterization. FDA has not identified any human exposure data on drug products containing MOTs-C administered via any route of administration. FDA lacks important information regarding any safety issues raised by MOTs-C, including whether it would cause harm if administered to humans." Drugs@FDA holds "no record found" for MOTS-c, and the EMA medicines report "no record found". 02 ## Why FDA can say there is no human exposure data MOTS-c is a 16-amino-acid peptide encoded in mitochondrial DNA. Its research is in mice and cells, which is why the Research Desk rates it animal and cell. People make MOTS-c naturally, and some studies measure its blood levels as a marker, but that is not the same as giving it as a product. 03 ## Philippines A search of fda.gov.ph for "MOTS-c" on 23 September 2026 returned no advisory, and the registration record could not be read from the FDA Philippines verification portal. 04 ## What the mouse work found In mice, MOTS-c prevented insulin resistance linked to age and a high-fat diet, and prevented diet-induced obesity. An approval would need human trials first, and none has been published. 05 ## How it is thought to act MOTS-c is a 16-amino-acid peptide encoded in mitochondrial DNA. In mouse and cell studies it acts mainly on skeletal muscle, where it inhibits the folate cycle and linked purine synthesis, which activates the energy sensor AMPK. In people, exercise raises the body's own MOTS-c levels; it has not been given to people in a published study. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for MOTS-c](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22MOTS-c%22&limit=10) · checked 23 September 2026 2. [EMA record for MOTS-c](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 3. [FDA, bulk drug substances that may present significant safety risks in compounding](https://www.fda.gov/drugs/human-drug-compounding/certain-bulk-drug-substances-use-compounding-may-present-significant-safety-risks) · checked 23 September 2026 4. [FDA Philippines site search, MOTS-c](https://www.fda.gov.ph/?s=MOTS-c) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [MOTS-c 10mg](https://www.primaralabs.com/marketplace/mots-c-10mg) - [Evidence Map: MOTS-c](https://www.primaralabs.com/research/evidence#mots-c) - [Regulatory Status Tracker: MOTS-c](https://www.primaralabs.com/research/status#mots-c) - [What is MOTS-c studied for?](https://www.primaralabs.com/answers/what-is-mots-c-studied-for) - [Is NAD+ FDA approved?](https://www.primaralabs.com/answers/is-nad-plus-fda-approved) --- URL: https://www.primaralabs.com/answers/is-cjc-1295-ipamorelin-fda-approved Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-cjc-1295-ipamorelin-fda-approved.md # Are CJC-1295 and ipamorelin FDA approved? No. As of 23 September 2026, neither CJC-1295 nor ipamorelin has an approved application with the US FDA or a record with the EMA. FDA lists both on its compounding safety-risk page, and says it has identified serious adverse events with CJC-1295, including increased heart rate. No FDA Philippines advisory names either. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## CJC-1295 FDA's compounding page (current as of 22 April 2026) says: "Compounded drugs containing CJC-1295 may pose risk for immunogenicity for certain routes of administration and may have complexities with regard to peptide-related impurities and API characterization. FDA has identified serious adverse events associated with CJC-1295 including increased heart rate and systemic vasodilatory reaction." Drugs@FDA: "no record found". EMA: "no record found". 02 ## Ipamorelin The same page says of ipamorelin acetate: "Compounded drugs containing Ipamorelin acetate may pose risk for immunogenicity for certain routes of administration due to the potential for aggregation or peptide-related impurities. Ipamorelin acetate also contains unnatural amino acids, which add to the complexity of peptide characterization." Drugs@FDA: "no record found". Ipamorelin reached a phase 2 trial after bowel surgery, which did not meet its main goal; the Research Desk rates its evidence phase 2 human. 03 ## Philippines Searches of fda.gov.ph for "CJC-1295" and "ipamorelin" on 23 September 2026 returned no advisory, and neither registration record could be read from the verification portal. 04 ## What FDA's page is, and is not FDA publishes the page to tell US compounding pharmacies which bulk substances it considers may present significant safety risks. It records hazards and evidence gaps; it is not an approval decision and does not rule on any product sold outside US compounding. The Research Desk rates CJC-1295's evidence as small human studies and ipamorelin's as phase 2 human. No published study has given the two together. 05 ## The human data Human data are two small pharmacology trials of the DAC form; the rest is animal work. One phase 2 human trial, which found no significant effect; the rest is animal work. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for CJC-1295](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22CJC-1295%22&limit=10) · checked 23 September 2026 2. [EMA record for CJC-1295](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 3. [FDA, bulk drug substances that may present significant safety risks in compounding](https://www.fda.gov/drugs/human-drug-compounding/certain-bulk-drug-substances-use-compounding-may-present-significant-safety-risks) · checked 23 September 2026 4. [US FDA record for Ipamorelin](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22ipamorelin%22&limit=10) · checked 23 September 2026 5. [FDA Philippines site search, ipamorelin](https://www.fda.gov.ph/?s=ipamorelin) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [CJC-1295 / Ipamorelin 5mg + 5mg](https://www.primaralabs.com/marketplace/cjc-1295-ipamorelin-10mg) - [Evidence Map: CJC-1295](https://www.primaralabs.com/research/evidence#cjc-1295) - [Evidence Map: ipamorelin](https://www.primaralabs.com/research/evidence#ipamorelin) - [What is CJC-1295 with ipamorelin?](https://www.primaralabs.com/answers/what-is-cjc-1295-ipamorelin) - [Is tesamorelin FDA approved?](https://www.primaralabs.com/answers/is-tesamorelin-fda-approved) --- URL: https://www.primaralabs.com/answers/is-kpv-approved-in-the-philippines Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-kpv-approved-in-the-philippines.md # Is KPV approved in the Philippines? No approval for KPV exists as of 23 September 2026. FDA Philippines warned the public on 4 September 2026 against an unregistered KPV multi-use vial, and the US FDA says it has found no human exposure data on KPV. Neither Drugs@FDA nor the EMA medicines report holds a KPV record. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The FDA Philippines advisory FDA Advisory No. 2026-1013, 4 September 2026: FDA Philippines warned the public against buying or using an unregistered KPV 10mg/1ml multi-use vial sold with bacteriostatic water, which had not been issued a Certificate of Product Registration. Like the tirzepatide warnings, it concerns one named product and states that it had no Certificate of Product Registration. It is the only FDA Philippines advisory naming KPV found on the date checked. 02 ## United States and Europe FDA's compounding page (current as of 22 April 2026) says: "FDA has not identified any human exposure data on drug products containing KPV administered via any route of administration. FDA lacks important information regarding any safety issues raised by KPV, including whether it would cause harm if administered to humans." Drugs@FDA: "no record found". EMA: "no record found". 03 ## What KPV is KPV is the last three amino acids of alpha-melanocyte-stimulating hormone. Its research is in mice, rats and cell culture, mainly colitis models, so the Research Desk rates it animal and cell. Primara Labs sells it only as a component of a blend. 04 ## What the animal work found In mice with chemically induced colitis, KPV reduced colitis and inflammatory cytokine expression. In rats with chemotherapy-induced mouth ulcers, KPV in an adhesive gel improved food intake and body-weight recovery. 05 ## How it is thought to act KPV is the last three amino acids of alpha-melanocyte-stimulating hormone. In cell studies it enters intestinal and immune cells through the peptide transporter PepT1 and dampens NF-kB and MAP kinase inflammatory signalling. A mouse study found its anti-inflammatory effect is unlikely to act through melanocortin receptors. This is general information, not legal advice. Sources ## Where every figure comes from 1. [US FDA record for KPV](https://api.fda.gov/drug/drugsfda.json?search=openfda.generic_name:%22KPV%22&limit=10) · checked 23 September 2026 2. [EMA record for KPV](https://www.ema.europa.eu/en/documents/report/medicines-output-medicines-report_en.xlsx) · checked 23 September 2026 3. [FDA, bulk drug substances that may present significant safety risks in compounding](https://www.fda.gov/drugs/human-drug-compounding/certain-bulk-drug-substances-use-compounding-may-present-significant-safety-risks) · checked 23 September 2026 4. [FDA Philippines Advisory 2026-1013](https://www.fda.gov.ph/fda-advisory-no-2026-1013-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-kpv-subcutaneous-use-only-10mg-1ml-multi-use-vial-and-bacteriostatic-water-ste/) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [KLOW Blend 80mg](https://www.primaralabs.com/marketplace/klow-blend-80mg) - [Evidence Map: KPV](https://www.primaralabs.com/research/evidence#kpv) - [FDA Philippines advisories](https://www.primaralabs.com/research/status) - [What is KPV studied for?](https://www.primaralabs.com/answers/what-is-kpv-studied-for) - [What has FDA Philippines warned about peptides?](https://www.primaralabs.com/answers/what-has-fda-philippines-warned-about-peptides) --- URL: https://www.primaralabs.com/answers/which-research-peptides-are-fda-approved Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/which-research-peptides-are-fda-approved.md # Which research peptides are FDA approved? Of the 16 compounds on the Primara Research Desk tracker, 4 are US FDA approved as branded medicines for named uses as of 23 September 2026: tirzepatide, semaglutide, tesamorelin, bremelanotide. Retatrutide is investigational, and 11 have no approved application at all. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## Approved in the United States, for a named use Tirzepatide: Approved for glycemic control in type 2 diabetes mellitus (Mounjaro); weight reduction in obesity or overweight with a comorbidity and moderate to severe obstructive sleep apnea in adults with obesity (Zepbound). Semaglutide: Approved for glycemic control in type 2 diabetes mellitus and related cardiovascular and kidney risk reduction (Ozempic, Rybelsus); chronic weight management and cardiovascular risk reduction in obesity or overweight (Wegovy). Tesamorelin: Approved for reduction of excess abdominal fat in HIV-infected adult patients with lipodystrophy. Bremelanotide: Approved for acquired, generalized hypoactive sexual desire disorder (HSDD) in premenopausal women. 02 ## Not approved Retatrutide: investigational; its sponsor plans a US Biologics License Application submission in Q1 2027. No approved application in Drugs@FDA: BPC-157, TB-500, NAD+, GHK-Cu, CJC-1295, Ipamorelin, MOTS-c, Semax, Selank, DSIP, KPV. FDA lists 10 of these on its page of bulk substances that may present significant safety risks in compounding. 03 ## What an approval covers An approval applies to a named medicine, from a named maker, for a named indication. It never makes a research-grade vial of the same compound an approved product. In the Philippines, registration is decided separately by FDA Philippines, and its verification portal could not be read for any of these compounds on the date checked. 04 ## Where to check each record Each status on the tracker links the record it was read from: the Drugs@FDA application for US approvals, the EMA medicines report for Europe, and the sponsor's own statement for a planned filing. The same data downloads as JSON and CSV, dated, so the list here can be checked line by line. This is general information, not legal advice. Sources ## Where every figure comes from 1. [Primara Research Desk, regulatory dataset](https://www.primaralabs.com/data/regulatory.json) · checked 23 September 2026 2. [Drugs@FDA](https://www.accessdata.fda.gov/scripts/cder/daf/) · checked 23 September 2026 3. [FDA, bulk drug substances that may present significant safety risks in compounding](https://www.fda.gov/drugs/human-drug-compounding/certain-bulk-drug-substances-use-compounding-may-present-significant-safety-risks) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Regulatory Status Tracker](https://www.primaralabs.com/research/status) - [Regulatory dataset](https://www.primaralabs.com/data#regulatory) - [Is tirzepatide approved in the Philippines?](https://www.primaralabs.com/answers/is-tirzepatide-approved-in-the-philippines) - [Is BPC-157 FDA approved?](https://www.primaralabs.com/answers/is-bpc-157-fda-approved) --- URL: https://www.primaralabs.com/answers/what-has-fda-philippines-warned-about-peptides Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-has-fda-philippines-warned-about-peptides.md # What has FDA Philippines warned about peptides? As of 23 September 2026, FDA Philippines has published 5 public health warnings naming compounds Primara Labs tracks: unregistered tirzepatide vial products, a KPV vial and an NAD+ supplement. It has also listed tirzepatide and semaglutide injections among VAT-exempt diabetes medicines. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The advisories, newest first FDA Advisory No. 2026-1020 (4 September 2026): FDA Philippines warned the public against buying or using an unregistered tirzepatide 30mg multi-use vial sold with bacteriostatic water, which had not been issued a Certificate of Product Registration. FDA Advisory No. 2026-1013 (4 September 2026): FDA Philippines warned the public against buying or using an unregistered KPV 10mg/1ml multi-use vial sold with bacteriostatic water, which had not been issued a Certificate of Product Registration. FDA Advisory No. 2026-1019 (4 September 2026): FDA Philippines warned the public against buying or using an unregistered tirzepatide product sold as Peptatide Tirzepatide 15mg with a bacteriostatic water kit, which had not been issued a Certificate of Product Registration. FDA Advisory No. 2026-0814 (30 July 2026): FDA Philippines warned the public against buying or using an unregistered tirzepatide product sold as Tirz Laine Tirzepatide 30mg/3 mL, which had not been issued a Certificate of Product Registration. FDA Advisory No. 2026-0596 (4 May 2026): FDA Philippines published updates to its list of VAT-exempt drugs and medicines under the CREATE Act, listing tirzepatide solutions for subcutaneous injection under medicines for diabetes. FDA Advisory No. 2026-0065 (6 February 2026): FDA Philippines published updates to its list of VAT-exempt health products under the CREATE Act, listing tirzepatide solutions for subcutaneous injection among drugs for diabetes. FDA Advisory No. 2025-1200 (6 November 2025): FDA Philippines published updates to its list of VAT-exempt health products under the CREATE Act, including seven semaglutide solutions for injection listed under drugs for diabetes. FDA Advisory No. 2025-0084 (30 January 2025): FDA Philippines warned the public against buying or consuming an unregistered liposomal NAD+ food supplement in capsules, for which no Certificate of Product Registration had been issued. 02 ## What the warnings have in common Each warning names one product, states that post-marketing surveillance found it had no Certificate of Product Registration, and asks the public not to buy or use it. The advisories cite Republic Act No. 9711, the Food and Drug Administration Act of 2009, which prohibits selling or distributing a health product without FDA authorization. An advisory speaks about the product it names. Its absence does not mean a compound is registered, and FDA Philippines' verification portal is where registration is checked. This is general information, not legal advice. Sources ## Where every figure comes from 1. [FDA Philippines Advisory 2026-1020](https://www.fda.gov.ph/fda-advisory-no-2026-1020-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-tirzepatide-subcutaneously-use-only-30mg-multi-use-vial-and-bac-water-0-9-benz/) · checked 23 September 2026 2. [FDA Philippines Advisory 2026-1013](https://www.fda.gov.ph/fda-advisory-no-2026-1013-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-kpv-subcutaneous-use-only-10mg-1ml-multi-use-vial-and-bacteriostatic-water-ste/) · checked 23 September 2026 3. [FDA Philippines Advisory 2026-1019](https://www.fda.gov.ph/fda-advisory-no-2026-1019-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-peptatide-tirzepatide-for-subcutaneously-use-only-15mg-and-peptatide-bacterios/) · checked 23 September 2026 4. [FDA Philippines Advisory 2026-0814](https://www.fda.gov.ph/fda-advisory-no-2026-0814-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-tirz-laine-tirzepatide-30mg-3-ml-99-purity/) · checked 23 September 2026 5. [FDA Philippines Advisory 2026-0596](https://www.fda.gov.ph/fda-advisory-no-2026-0596-endorsement-of-updates-on-the-list-of-vat-exempt-drugs-and-medicines/) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [FDA Philippines advisories dataset](https://www.primaralabs.com/data#fda-ph-advisories) - [Regulatory Status Tracker](https://www.primaralabs.com/research/status) - [How do you check if a product is registered with FDA Philippines?](https://www.primaralabs.com/answers/how-to-check-fda-philippines-registration) - [Is tirzepatide approved in the Philippines?](https://www.primaralabs.com/answers/is-tirzepatide-approved-in-the-philippines) --- URL: https://www.primaralabs.com/answers/how-to-check-fda-philippines-registration Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/how-to-check-fda-philippines-registration.md # How do you check if a product is registered with FDA Philippines? FDA Philippines tells the public to check registration on its verification portal at verification.fda.gov.ph, and it keeps a separate list of health products it has found unregistered. Both are named in its own advisories, read on 23 September 2026. A registered product carries a Certificate of Product Registration. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The two places FDA Philippines names Every public health warning FDA Philippines issued on the peptide products tracked here ends the same way: it asks the public to check whether products are registered using the FDA Verification Portal at verification.fda.gov.ph, and it links its list of health products found unregistered, at fda.gov.ph/list-of-unregistered-health-products. The portal is searched by product or generic name. A registered drug appears with its Certificate of Product Registration, the authorization the advisories say an unregistered product lacks. 02 ## What each check can and cannot tell you A portal result tells you whether a specific product is registered, not whether a compound in general is. An advisory tells you FDA Philippines found one named product unregistered; the lack of an advisory proves nothing either way. On 23 September 2026 the portal's search did not respond, so the Primara Research Desk records FDA Philippines registration as not established for all 16 compounds it tracks rather than guessing. 03 ## Reporting a product The same advisories point to FDA Philippines' eSumbong system for reporting continued sale of an unregistered product, and to a form for reporting a suspected adverse drug reaction. 04 ## Why the Research Desk shows "not established" The tracker tried the portal's search for every compound on 23 September 2026, from a script and again in a browser, and received no answer either way. Rather than infer a status from an advisory about someone else's product, each compound's FDA Philippines status is left as not established, with the attempt recorded, until the portal can be read. This is general information, not legal advice. Sources ## Where every figure comes from 1. [FDA Philippines Advisory 2026-1020](https://www.fda.gov.ph/fda-advisory-no-2026-1020-public-health-warning-against-the-purchase-and-use-of-the-unregistered-drug-product-tirzepatide-subcutaneously-use-only-30mg-multi-use-vial-and-bac-water-0-9-benz/) · checked 23 September 2026 2. [FDA Philippines verification portal](https://verification.fda.gov.ph/) · checked 23 September 2026 3. [FDA Philippines list of unregistered health products](https://www.fda.gov.ph/list-of-unregistered-health-products/) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Regulatory Status Tracker](https://www.primaralabs.com/research/status) - [What has FDA Philippines warned about peptides?](https://www.primaralabs.com/answers/what-has-fda-philippines-warned-about-peptides) - [Which research peptides are FDA approved?](https://www.primaralabs.com/answers/which-research-peptides-are-fda-approved) --- URL: https://www.primaralabs.com/answers/how-does-retatrutide-work Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/how-does-retatrutide-work.md # How does retatrutide work? Retatrutide is a single peptide that activates three hormone receptors at once: GIP, GLP-1 and glucagon, which its developer Eli Lilly calls a first-in-class triple agonist. As of 23 September 2026 it is investigational, studied in phase 3 trials for obesity, type 2 diabetes and knee osteoarthritis pain. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The three receptors Retatrutide is a single peptide that activates three receptors: GIP, GLP-1 and glucagon. Lilly describes it as a first-in-class triple hormone receptor agonist. GLP-1 and GIP are incretins, gut hormones released after eating that act on insulin secretion and appetite signalling. Glucagon receptor activity is the part that sets retatrutide apart from dual agonists: glucagon acts on the liver and on energy expenditure. Tirzepatide acts on two of these receptors and semaglutide on one. 02 ## What the trials measured The Research Desk rates retatrutide's evidence as phase 3 human. In TRIUMPH-1, a phase 3 trial in adults with obesity, or overweight with at least one weight-related condition, without diabetes (n=2,339), mean body weight fell 28.3% on the 12 mg arm over 80 weeks, against 2.2% lost on placebo (efficacy estimand). In TRIUMPH-2, a phase 3 trial in adults with type 2 diabetes and obesity or overweight lasting 80 weeks, a1C fell 1.4, 1.6 and 1.5 points from a baseline of 7.7% on 4, 9 and 12 mg, against 0.2 on placebo. 03 ## Adverse events in the same trial In TRIUMPH-1, discontinuation because of adverse events was 4.1% on 4 mg, 6.9% on 9 mg and 11.3% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were nausea in 28.6% on 4 mg, 38.4% on 9 mg and 42.4% on 12 mg against 14.8% on placebo, diarrhoea in 25.2% on 4 mg, 34.1% on 9 mg and 32.0% on 12 mg against 13.5% on placebo, constipation in 23.8% on 4 mg, 25.9% on 9 mg and 26.1% on 12 mg against 10.9% on placebo and vomiting in 10.6% on 4 mg, 22.8% on 9 mg and 25.3% on 12 mg against 4.8% on placebo. Sources ## Where every figure comes from 1. [Eli Lilly, retatrutide mechanism](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 2. [Eli Lilly topline release, 21 May 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss) · checked 23 September 2026 3. [Eli Lilly topline release, 23 July 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) - [TRIUMPH-1 on the Trial Explorer](https://www.primaralabs.com/research/trials/triumph-1) - [Retatrutide vs tirzepatide: trial data](https://www.primaralabs.com/research/compare/retatrutide-vs-tirzepatide) - [What did the retatrutide trials find?](https://www.primaralabs.com/answers/what-did-retatrutide-trials-find) - [What are the side effects of retatrutide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-retatrutide) --- URL: https://www.primaralabs.com/answers/what-did-retatrutide-trials-find Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-did-retatrutide-trials-find.md # What did the retatrutide trials find? As of 23 September 2026, 5 retatrutide trials have reported. In TRIUMPH-1, a phase 3 trial of adults with obesity or overweight without diabetes, mean body weight fell by up to 28.3% over 80 weeks on the highest dose arm, reported by Eli Lilly. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## Phase 3: the TRIUMPH programme In TRIUMPH-1, a phase 3 trial of retatrutide in adults with obesity, or overweight with at least one weight-related condition, without diabetes (n=2,339), mean body weight fell 19.0% on 4 mg, 25.9% on 9 mg and 28.3% on 12 mg over 80 weeks, against 2.2% on placebo (efficacy estimand; Eli Lilly topline release, 21 May 2026). In TRIUMPH-2, a phase 3 trial of retatrutide in adults with type 2 diabetes and obesity or overweight (n=1,152), mean body weight fell 12.7% on 4 mg, 19.1% on 9 mg and 20.8% on 12 mg over 80 weeks, against 4.0% on placebo (efficacy estimand; Eli Lilly topline release, 23 July 2026). In TRIUMPH-3, a phase 3 trial of retatrutide in adults with severe obesity (BMI of 35 or more) and established cardiovascular disease, with or without type 2 diabetes (n=1,949), mean body weight fell 21.6% on 9 mg and 22.6% on 12 mg over 80 weeks, against 3.2% on placebo (efficacy estimand; Eli Lilly topline release, 23 July 2026). In TRIUMPH-4, a phase 3 trial of retatrutide in adults with obesity or overweight and knee osteoarthritis, without diabetes (n=445), mean body weight fell 26.4% on 9 mg and 28.7% on 12 mg over 68 weeks, against 2.1% on placebo (efficacy estimand; Eli Lilly topline release, 11 December 2025). 02 ## Phase 2 In Retatrutide phase 2 (Jastreboff), a phase 2 trial of retatrutide in adults with a BMI of 30 or more, or 27 to under 30 with at least one weight-related condition (n=338), mean body weight fell 8.7% on 1 mg, 17.1% on 4 mg (pooled), 22.8% on 8 mg (pooled) and 24.2% on 12 mg over 48 weeks, against 2.1% on placebo (Jastreboff AM et al. N Engl J Med 2023;389:514-526). 03 ## Adverse events and discontinuation Gastrointestinal events were the most frequent adverse events in both trials that report them by arm. Stopping because of adverse events ranged from 4.1% to 11.3% across the TRIUMPH-1 arms against 4.9% on placebo, and from 12.2% to 18.2% in TRIUMPH-4 against 4.0%. Every per-event rate, arm by arm, is on the retatrutide side-effects answer and in the adverse events dataset. Sources ## Where every figure comes from 1. [Eli Lilly topline release, 21 May 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss) · checked 23 September 2026 2. [Eli Lilly topline release, 23 July 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 3. [Eli Lilly topline release, 23 July 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-successful-two-additional) · checked 23 September 2026 4. [Eli Lilly topline release, 11 December 2025](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-weight-loss-average) · checked 23 September 2026 5. [Jastreboff AM et al. N Engl J Med 2023;389:514-526](https://doi.org/10.1056/NEJMoa2301972) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) - [Trial Explorer](https://www.primaralabs.com/research/trials) - [Retatrutide vs semaglutide: trial data](https://www.primaralabs.com/research/compare/retatrutide-vs-semaglutide) - [What are the side effects of retatrutide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-retatrutide) - [When will retatrutide be approved?](https://www.primaralabs.com/answers/when-will-retatrutide-be-approved) --- URL: https://www.primaralabs.com/answers/what-are-the-side-effects-of-retatrutide Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-are-the-side-effects-of-retatrutide.md # What are the side effects of retatrutide? In TRIUMPH-1, the retatrutide phase 3 trial reported by Eli Lilly (checked 23 September 2026), nausea affected 28.6% to 42.4% of participants across the dose arms against 14.8% on placebo, and diarrhoea, constipation and vomiting were also more common. Stopping because of adverse events ranged from 4.1% to 11.3% against 4.9%. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## TRIUMPH-1 In TRIUMPH-1, discontinuation because of adverse events was 4.1% on 4 mg, 6.9% on 9 mg and 11.3% on 12 mg, against 4.9% on placebo. The most frequently reported adverse events were nausea in 28.6% on 4 mg, 38.4% on 9 mg and 42.4% on 12 mg against 14.8% on placebo, diarrhoea in 25.2% on 4 mg, 34.1% on 9 mg and 32.0% on 12 mg against 13.5% on placebo, constipation in 23.8% on 4 mg, 25.9% on 9 mg and 26.1% on 12 mg against 10.9% on placebo and vomiting in 10.6% on 4 mg, 22.8% on 9 mg and 25.3% on 12 mg against 4.8% on placebo. 02 ## TRIUMPH-4 and phase 2 In TRIUMPH-4, discontinuation because of adverse events was 12.2% on 9 mg and 18.2% on 12 mg, against 4.0% on placebo. The most frequently reported adverse events were nausea in 38.1% on 9 mg and 43.2% on 12 mg against 10.7% on placebo, diarrhoea in 34.7% on 9 mg and 33.1% on 12 mg against 13.4% on placebo, constipation in 21.8% on 9 mg and 25.0% on 12 mg against 8.7% on placebo and vomiting in 20.4% on 9 mg and 20.9% on 12 mg against 0.0% on placebo. Retatrutide phase 2 (Jastreboff): The abstract reports gastrointestinal events as the most common, dose-related and mostly mild to moderate, without rates; rates by arm are in the full text, not read here. 03 ## The outcomes these rates sit beside In TRIUMPH-1, a phase 3 trial in adults with obesity, or overweight with at least one weight-related condition, without diabetes (n=2,339), mean body weight fell 28.3% on the 12 mg arm over 80 weeks, against 2.2% lost on placebo (efficacy estimand). In TRIUMPH-4, a phase 3 trial in adults with obesity or overweight and knee osteoarthritis, without diabetes lasting 68 weeks, WOMAC pain fell 4.5 and 4.4 points from a baseline of 6.0 on 9 and 12 mg, against 2.4 on placebo. Adverse event rates are reported per trial arm, and the arms are fixed trial doses reached by a scheduled escalation inside the study; the rates describe those trials and nothing outside them. Sources ## Where every figure comes from 1. [Eli Lilly topline release, 21 May 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss) · checked 23 September 2026 2. [Eli Lilly topline release, 11 December 2025](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-weight-loss-average) · checked 23 September 2026 3. [Jastreboff AM et al. N Engl J Med 2023;389:514-526](https://doi.org/10.1056/NEJMoa2301972) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) - [Adverse events dataset](https://www.primaralabs.com/data#trial-adverse-events) - [TRIUMPH-4 on the Trial Explorer](https://www.primaralabs.com/research/trials/triumph-4) - [What did the retatrutide trials find?](https://www.primaralabs.com/answers/what-did-retatrutide-trials-find) - [What are the side effects of tirzepatide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-tirzepatide) --- URL: https://www.primaralabs.com/answers/how-does-tirzepatide-work Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/how-does-tirzepatide-work.md # How does tirzepatide work? Tirzepatide is one peptide that activates two incretin receptors, GIP and GLP-1, which is why it is called a dual agonist. As of 23 September 2026 it is the active ingredient in US-approved prescription medicines, and its SURMOUNT phase 3 trials measured body-weight change in adults with obesity, with and without type 2 diabetes. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## Two receptors in one molecule Tirzepatide is a single peptide that activates two receptors: GIP (glucose-dependent insulinotropic polypeptide) and GLP-1. Semaglutide activates GLP-1 alone, and retatrutide adds the glucagon receptor to these two. GIP and GLP-1 are both released by the gut after a meal, and both act on insulin release and appetite signalling. 02 ## What SURMOUNT measured In SURMOUNT-1, a phase 3 trial of tirzepatide in adults with BMI of 30 or more, or 27 or more with at least one weight-related complication, excluding diabetes (n=2,539), mean body weight fell 15.0% on 5 mg, 19.5% on 10 mg and 20.9% on 15 mg over 72 weeks, against 3.1% on placebo (treatment-regimen estimand; Jastreboff AM et al. N Engl J Med 2022;387:205-216). In SURMOUNT-5, a phase 3b head-to-head trial in adults with obesity but without type 2 diabetes (n=751), mean body weight fell 20.2% on tirzepatide against 13.7% on semaglutide over 72 weeks. 03 ## Adverse events In SURMOUNT-1, discontinuation because of adverse events was 4.3% on 5 mg, 7.1% on 10 mg and 6.2% on 15 mg, against 2.6% on placebo. 04 ## With type 2 diabetes In SURMOUNT-2, a phase 3 trial in adults (18 or older) with BMI of 27 kg/m2 or higher and type 2 diabetes with HbA1c 7-10% (53-86 mmol/mol), in seven countries (n=938), mean body weight fell 14.7% on the 15 mg arm over 72 weeks, against 3.2% lost on placebo (treatment-regimen estimand). The estimand in brackets says which question a figure answers: an efficacy estimand counts people while they stayed on treatment, and a treatment-regimen or treatment-policy estimand counts everyone randomised, whatever happened later, so it usually reads lower. Sources ## Where every figure comes from 1. [Tirzepatide mechanism source](https://doi.org/10.1056/NEJMoa2206038) · checked 23 September 2026 2. [Jastreboff AM et al. N Engl J Med 2022;387:205-216](https://doi.org/10.1056/NEJMoa2206038) · checked 23 September 2026 3. [Aronne LJ et al. N Engl J Med 2025 (SURMOUNT-5)](https://doi.org/10.1056/NEJMoa2416394) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Tirzepatide 15mg](https://www.primaralabs.com/marketplace/tirzepatide-15mg) - [SURMOUNT-1 on the Trial Explorer](https://www.primaralabs.com/research/trials/surmount-1) - [Tirzepatide vs semaglutide: trial data](https://www.primaralabs.com/research/compare/tirzepatide-vs-semaglutide) - [What are the side effects of tirzepatide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-tirzepatide) - [Is tirzepatide approved in the Philippines?](https://www.primaralabs.com/answers/is-tirzepatide-approved-in-the-philippines) --- URL: https://www.primaralabs.com/answers/what-are-the-side-effects-of-tirzepatide Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-are-the-side-effects-of-tirzepatide.md # What are the side effects of tirzepatide? In SURMOUNT-3, a phase 3 trial of tirzepatide (checked 23 September 2026), nausea was reported by 39.7% of participants against 14.0% on placebo, with diarrhoea, constipation and vomiting also more frequent. Discontinuation because of adverse events was 10.5% against 2.1%, and in SURMOUNT-1 4.3% to 7.1% against 2.6%. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## SURMOUNT-1 In SURMOUNT-1, discontinuation because of adverse events was 4.3% on 5 mg, 7.1% on 10 mg and 6.2% on 15 mg, against 2.6% on placebo. 02 ## SURMOUNT-3 In SURMOUNT-3, discontinuation because of adverse events was 10.5% on maximum tolerated dose (10 or 15 mg), against 2.1% on placebo. The most frequently reported adverse events were nausea in 39.7% on maximum tolerated dose (10 or 15 mg) against 14.0% on placebo, diarrhoea in 31.0% on maximum tolerated dose (10 or 15 mg) against 9.2% on placebo, constipation in 23.0% on maximum tolerated dose (10 or 15 mg) against 6.8% on placebo and vomiting in 18.1% on maximum tolerated dose (10 or 15 mg) against 1.4% on placebo. 03 ## The results beside them In SURMOUNT-3, a phase 3 trial of tirzepatide in adults with BMI of 30 or more, or 27 or more with at least one obesity-related complication (excluding diabetes), who achieved 5.0% or more weight reduction after a 12-week intensive lifestyle intervention (n=579), mean body weight changed by -18.4% on maximum tolerated dose (10 or 15 mg) over 72 weeks, against +2.5% on placebo (treatment-regimen estimand; Wadden TA et al. Nat Med 2023 (SURMOUNT-3)). In SURMOUNT-4, a phase 3 withdrawal trial (n=670), participants who continued tirzepatide after a 36-week lead-in lost a further 5.5% by week 88, while those switched to placebo regained 14.0%. 04 ## Reading these rates Each figure is the share of participants on an arm who reported the event at least once during the trial, set against the same share on placebo. The difference between the two is the part attributable to the trial treatment; the placebo figure shows how common the event is anyway. Sources ## Where every figure comes from 1. [Jastreboff AM et al. N Engl J Med 2022;387:205-216](https://doi.org/10.1056/NEJMoa2206038) · checked 23 September 2026 2. [Wadden TA et al. Nat Med 2023 (SURMOUNT-3)](https://doi.org/10.1038/s41591-023-02597-w) · checked 23 September 2026 3. [Aronne LJ et al. JAMA 2024 (SURMOUNT-4)](https://doi.org/10.1001/jama.2023.24945) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Tirzepatide 15mg](https://www.primaralabs.com/marketplace/tirzepatide-15mg) - [Adverse events dataset](https://www.primaralabs.com/data#trial-adverse-events) - [SURMOUNT-3 on the Trial Explorer](https://www.primaralabs.com/research/trials/surmount-3) - [How does tirzepatide work?](https://www.primaralabs.com/answers/how-does-tirzepatide-work) - [What are the side effects of semaglutide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-semaglutide) --- URL: https://www.primaralabs.com/answers/how-does-semaglutide-work Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/how-does-semaglutide-work.md # How does semaglutide work? Semaglutide is a modified form of the gut hormone GLP-1 that binds and activates the GLP-1 receptor, and only that receptor. As of 23 September 2026 it is the active ingredient in US-approved prescription medicines, studied in the STEP weight trials and in SELECT, a cardiovascular outcomes trial of 17,604 people. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## One receptor Semaglutide is a GLP-1 analogue that selectively binds to and activates the GLP-1 receptor, the target of native GLP-1. Native GLP-1 lasts minutes in the blood; semaglutide is modified so that it lasts far longer, which is what allows weekly use in the approved medicines. Tirzepatide adds GIP receptor activity and retatrutide adds glucagon as well. 02 ## What the trials measured In STEP 1, a phase 3 trial of semaglutide in adults with BMI of 30 or greater (27 or greater with at least one weight-related coexisting condition), without diabetes (n=1,961), mean body weight fell 14.9% on 2.4 mg over 68 weeks, against 2.4% on placebo (treatment-policy estimand; Wilding JPH et al. N Engl J Med 2021;384:989-1002). In SELECT, a phase 3 trial of semaglutide in patients 45 years or older with preexisting cardiovascular disease and BMI of 27 or greater, no history of diabetes (n=17,604), the primary endpoint, death from cardiovascular causes, nonfatal myocardial infarction or nonfatal stroke, occurred in 6.5% on semaglutide against 8.0% on placebo, a hazard ratio of 0.80 (95% CI 0.72 to 0.90) (Lincoff AM et al. N Engl J Med 2023 (SELECT)). 03 ## Adverse events In STEP 3, discontinuation because of adverse events was 5.9% on 2.4 mg, against 2.9% on placebo. The most frequently reported adverse events were gastrointestinal adverse events in 82.8% on 2.4 mg against 63.2% on placebo, nausea in 58.2% on 2.4 mg against 22.1% on placebo, constipation in 36.9% on 2.4 mg against 24.5% on placebo and diarrhoea in 36.1% on 2.4 mg against 22.1% on placebo. Sources ## Where every figure comes from 1. [Semaglutide mechanism source](https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=42bdd912-2393-44c4-b7e0-47672ca28991) · checked 23 September 2026 2. [Wilding JPH et al. N Engl J Med 2021;384:989-1002](https://doi.org/10.1056/NEJMoa2032183) · checked 23 September 2026 3. [Lincoff AM et al. N Engl J Med 2023 (SELECT)](https://doi.org/10.1056/NEJMoa2307563) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) - [SELECT on the Trial Explorer](https://www.primaralabs.com/research/trials/select) - [Tirzepatide vs semaglutide: trial data](https://www.primaralabs.com/research/compare/tirzepatide-vs-semaglutide) - [What are the side effects of semaglutide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-semaglutide) - [Is semaglutide approved in the Philippines?](https://www.primaralabs.com/answers/is-semaglutide-approved-in-the-philippines) --- URL: https://www.primaralabs.com/answers/what-are-the-side-effects-of-semaglutide Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-are-the-side-effects-of-semaglutide.md # What are the side effects of semaglutide? In STEP 3, a phase 3 trial of semaglutide (checked 23 September 2026), nausea was reported by 58.2% of participants against 22.1% on placebo, and constipation, diarrhoea and vomiting were also more frequent. In SELECT, the 17,604-person cardiovascular trial, 16.6% stopped semaglutide for adverse events against 8.2% on placebo. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## STEP 3 and STEP 8 In STEP 3, discontinuation because of adverse events was 5.9% on 2.4 mg, against 2.9% on placebo. The most frequently reported adverse events were gastrointestinal adverse events in 82.8% on 2.4 mg against 63.2% on placebo, nausea in 58.2% on 2.4 mg against 22.1% on placebo, constipation in 36.9% on 2.4 mg against 24.5% on placebo and diarrhoea in 36.1% on 2.4 mg against 22.1% on placebo. In STEP 8, discontinuation because of adverse events was 3.2% on semaglutide 2.4 mg and 12.6% on liraglutide 3.0 mg, against 3.5% on placebo (pooled). The most frequently reported adverse events were gastrointestinal disorders in 84.1% on semaglutide 2.4 mg and 82.7% on liraglutide 3.0 mg against 55.3% on placebo (pooled), nausea in 61.1% on semaglutide 2.4 mg and 59.1% on liraglutide 3.0 mg against 22.4% on placebo (pooled), constipation in 38.9% on semaglutide 2.4 mg and 31.5% on liraglutide 3.0 mg against 23.5% on placebo (pooled) and diarrhoea in 27.8% on semaglutide 2.4 mg and 18.1% on liraglutide 3.0 mg against 25.9% on placebo (pooled). 02 ## SELECT In SELECT, discontinuation because of adverse events was 16.6% on semaglutide 2.4 mg, against 8.2% on placebo. 03 ## The outcomes they sit beside In STEP 3, a phase 3 trial of semaglutide in US adults without diabetes with overweight (BMI 27 or greater) plus at least 1 comorbidity or obesity (BMI 30 or greater) (n=611), mean body weight fell 16.0% on 2.4 mg over 68 weeks, against 5.7% on placebo (treatment-policy estimand; Wadden TA et al. JAMA 2021 (STEP 3)). In STEP 4, a phase 3 withdrawal trial (n=803), participants who continued semaglutide after a 20-week run-in lost a further 7.9% by week 68, while those switched to placebo regained 6.9%. Sources ## Where every figure comes from 1. [Wadden TA et al. JAMA 2021 (STEP 3)](https://doi.org/10.1001/jama.2021.1831) · checked 23 September 2026 2. [Rubino DM et al. JAMA 2022 (STEP 8)](https://doi.org/10.1001/jama.2021.23619) · checked 23 September 2026 3. [Lincoff AM et al. N Engl J Med 2023 (SELECT)](https://doi.org/10.1056/NEJMoa2307563) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Semaglutide 15mg](https://www.primaralabs.com/marketplace/semaglutide-15mg) - [Adverse events dataset](https://www.primaralabs.com/data#trial-adverse-events) - [STEP 8 on the Trial Explorer](https://www.primaralabs.com/research/trials/step-8) - [How does semaglutide work?](https://www.primaralabs.com/answers/how-does-semaglutide-work) - [What are the side effects of tirzepatide?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-tirzepatide) --- URL: https://www.primaralabs.com/answers/is-there-human-research-on-bpc-157 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/is-there-human-research-on-bpc-157.md # Is there human research on BPC-157? Very little. As of 23 September 2026, the human research on BPC-157 is two small uncontrolled reports, in interstitial cystitis and knee pain, with no randomised placebo-controlled trial found. Almost everything else is rat and cell work on tendon, ligament, muscle and gut injury, so the Research Desk rates it small human studies. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The two human reports In an uncontrolled pilot of 12 women with interstitial cystitis, 10 reported complete symptom resolution; there was no placebo or comparison group. In a retrospective phone survey of 16 clinic patients, 14 reported knee pain relief; there was no control group and no validated outcome measure. 02 ## The animal work behind it In rats with a cut Achilles tendon, BPC-157 improved mechanical, functional and microscopic healing measures compared with saline. This is a rat study, and results in rats do not establish effects in people. In rats with a surgically cut knee ligament, BPC-157 improved functional, mechanical and tissue measures of healing over 90 days. Also in rats. BPC-157 is a synthetic 15-amino-acid peptide. A 2025 systematic review summarises animal and cell studies as showing raised growth hormone receptor expression, activation of pathways for cell growth and new blood vessel formation, and lower inflammatory signalling. No receptor has been identified, and the same review notes it is broken down quickly in the liver. None of these mechanisms has been shown in people. 03 ## Safety data The two small uncontrolled pilots, of 2 and 12 people, reported no adverse events. A 2025 systematic review states that no clinical safety data were found. No randomised controlled human trial of BPC-157 was found in the Europe PMC search the Research Desk ran. 04 ## What a stronger study would look like The step that would change BPC-157's evidence level is a randomised trial with a placebo or comparison group, a named outcome measured the same way in both groups, and adverse events recorded by arm. None has been published. Sources ## Where every figure comes from 1. [PubMed 39325560](https://pubmed.ncbi.nlm.nih.gov/39325560/) · checked 23 September 2026 2. [PubMed 34324435](https://pubmed.ncbi.nlm.nih.gov/34324435/) · checked 23 September 2026 3. [J Orthop Res 2003](https://doi.org/10.1016/s0736-0266(03)00110-4) · checked 23 September 2026 4. [HSS J 2025 (systematic review)](https://doi.org/10.1177/15563316251355551) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [BPC-157 20mg](https://www.primaralabs.com/marketplace/bpc-157-20mg) - [Evidence Map: BPC-157](https://www.primaralabs.com/research/evidence#bpc-157) - [Benefits dataset](https://www.primaralabs.com/data#benefits) - [What are the side effects of BPC-157?](https://www.primaralabs.com/answers/what-are-the-side-effects-of-bpc-157) - [Is BPC-157 FDA approved?](https://www.primaralabs.com/answers/is-bpc-157-fda-approved) --- URL: https://www.primaralabs.com/answers/what-are-the-side-effects-of-bpc-157 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-are-the-side-effects-of-bpc-157.md # What are the side effects of BPC-157? The honest answer is that BPC-157's side effects in people are not known. As of 23 September 2026, the two small uncontrolled human reports recorded no adverse events, but a 2025 systematic review found no clinical safety data, and the US FDA says it has identified no, or only limited, safety information. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## What has been recorded The two small uncontrolled pilots, of 2 and 12 people, reported no adverse events. A 2025 systematic review states that no clinical safety data were found. 02 ## Why the absence of reports is not evidence of safety Both reports were small and had no control group, and neither was designed to detect side effects. Absence of reported events in studies that small says little: an uncommon event would usually not appear at all. The US FDA put it this way on its compounding page, current as of 22 April 2026: "Compounded drugs containing BPC-157 may pose risk for immunogenicity for certain routes of administration and may have complexities with regard to peptide-related impurities and active pharmaceutical ingredient (API) characterization. FDA has identified no, or only limited, safety-related information for the proposed routes of administration. Therefore, the agency lacks sufficient information to know whether the drug would cause harm when administered to humans." 03 ## Where the research is The Research Desk rates BPC-157's evidence small human studies. The human reports are described on its Evidence Map row, alongside the rat studies of tendon, ligament and gut injury that make up most of the literature. 04 ## Reading a "no side effects" claim A post or listing that says BPC-157 has no side effects is describing an absence of data, not a finding. The literature behind it is mostly rat work on tendon, ligament and gut injury, and the Research Desk lists those papers with what each measured. Animal and cell studies only. BPC-157 has been studied mostly in rats, in models of tendon, ligament, muscle and gut injury. Sources ## Where every figure comes from 1. [HSS J 2025 (systematic review)](https://doi.org/10.1177/15563316251355551) · checked 23 September 2026 2. [FDA, bulk drug substances that may present significant safety risks in compounding](https://www.fda.gov/drugs/human-drug-compounding/certain-bulk-drug-substances-use-compounding-may-present-significant-safety-risks) · checked 23 September 2026 3. [Europe PMC search, BPC-157](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22BPC-157%22%20OR%20TITLE_ABS%3A%22BPC%20157%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [BPC-157 20mg](https://www.primaralabs.com/marketplace/bpc-157-20mg) - [Evidence Map: BPC-157](https://www.primaralabs.com/research/evidence#bpc-157) - [Regulatory Status Tracker: BPC-157](https://www.primaralabs.com/research/status#bpc-157) - [Is there human research on BPC-157?](https://www.primaralabs.com/answers/is-there-human-research-on-bpc-157) - [Is BPC-157 FDA approved?](https://www.primaralabs.com/answers/is-bpc-157-fda-approved) --- URL: https://www.primaralabs.com/answers/what-is-tb-500 Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-is-tb-500.md # What is TB-500? TB-500 is a synthetic peptide named after thymosin beta-4, a 43-amino-acid protein that binds actin in cells. The analytical literature identifies TB-500 as an acetylated short fragment of that protein. As of 23 September 2026, its research is in animals and cells only; human trials used the full-length protein instead. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The molecule Thymosin beta-4 is a 43-amino-acid protein and the main actin-sequestering molecule in cells. Its central actin-binding sequence, LKKTETQ, is reported to promote cell migration, new blood vessel growth and wound healing, and TB-500 is described in the analytical literature as the acetylated form of that fragment. A 2024 cell study found the wound-healing activity came from a TB-500 breakdown product rather than TB-500 itself. That distinction matters because a product sold as TB-500 and a product sold as thymosin beta-4 are not the same substance, and results for one do not describe the other. 02 ## What the animal and cell work found In aged and diabetic mice, the seven-amino-acid thymosin beta-4 fragment LKKTETQ promoted skin wound repair about as well as the full-length protein. This was in mice. In a cell scratch-wound test, the TB-500 breakdown product Ac-LKKTE showed wound-healing activity, while TB-500 itself did not. This was in cells in a dish. Animal and cell studies only for TB-500. Human trials exist for full-length thymosin beta-4, a different molecule, mostly as eye drops; see the Evidence Map. 03 ## Human data No human adverse event data exist for TB-500. In the phase 3 trial of full-length thymosin beta-4 eye drops (ARISE-3), a different molecule, instillation site pain occurred in 6.6% against 4.6% on placebo. The US FDA lists the fragment on its compounding safety-risk page and states that it has not identified human exposure data. The Research Desk rates TB-500's evidence as animal and cell. 04 ## The papers behind it Animal and cell studies only for TB-500. Human trials exist for full-length thymosin beta-4, a different molecule, mostly as eye drops; see the Evidence Map. Wound Repair Regen 2003: In aged and diabetic mice, the seven-amino-acid fragment LKKTETQ promoted skin wound repair about as well as full-length thymosin beta-4. J Chromatogr B 2024: In a cell scratch-wound test, only the TB-500 breakdown product Ac-LKKTE showed wound-healing activity, not TB-500 itself. Jt Dis Relat Surg 2026: A rat Achilles tendon repair study described its molecule as synthetic thymosin beta-4 (TB-500) without stating the sequence in the abstract. Sources ## Where every figure comes from 1. [Thymosin beta-4 and TB-500 source](https://doi.org/10.1096/fj.09-142307) · checked 23 September 2026 2. [Wound Repair Regen 2003](https://doi.org/10.1046/j.1524-475x.2003.11105.x) · checked 23 September 2026 3. [J Chromatogr B 2024](https://doi.org/10.1016/j.jchromb.2024.124033) · checked 23 September 2026 4. [ClinicalTrials.gov NCT03937882 results](https://clinicaltrials.gov/study/NCT03937882) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [TB-500 10mg](https://www.primaralabs.com/marketplace/tb-500-10mg) - [Evidence Map: TB-500](https://www.primaralabs.com/research/evidence#tb-500) - [Regulatory Status Tracker: TB-500](https://www.primaralabs.com/research/status#tb-500) - [Is TB-500 FDA approved?](https://www.primaralabs.com/answers/is-tb-500-fda-approved) - [Is there human research on BPC-157?](https://www.primaralabs.com/answers/is-there-human-research-on-bpc-157) --- URL: https://www.primaralabs.com/answers/what-does-ghk-cu-do-in-research Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-does-ghk-cu-do-in-research.md # What does GHK-Cu do in research? GHK-Cu is a naturally occurring tripeptide that binds copper, studied for skin and wound repair. As of 23 September 2026, its human evidence is two small topical trials: one found faster diabetic foot ulcer closure with a GHK-Cu gel, the other found no measurable difference after laser resurfacing. The rest is cell and animal work. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## What it is GHK is a tripeptide (glycine, histidine, lysine) found in human plasma, saliva and urine, and it binds copper. In laboratory work it stimulates both the production and the breakdown of collagen and related skin matrix molecules, and adjusts the enzymes that remodel tissue. The evidence for these actions comes from cell and animal studies. 02 ## Human trials In a randomised, evaluator-blinded, placebo-controlled trial of a GHK-Cu gel on diabetic foot ulcers, median ulcer closure was 98.5% with the gel against 60.8% with the inactive gel; the abstract does not state the trial's size or phase. In 13 randomised patients after laser skin resurfacing, GHK-Cu skin care made no measurable difference to redness, wrinkles or blinded ratings, though patients rated their skin quality higher. 03 ## Animal and cell studies In rats after knee ligament reconstruction, GHK-Cu reduced knee laxity at 6 weeks, but the difference had gone by 12 weeks. This was in rats. In cell culture, GHK-Cu shortened the doubling time of normal and irradiated human skin fibroblasts and raised their early output of growth factors. 04 ## Safety data The Research Desk found no published human adverse event data for GHK-Cu in its Europe PMC search (23 September 2026). The US FDA lists GHK-Cu for injectable routes on its compounding safety-risk page, noting limited human data; the human trials above were topical. 05 ## Topical, not injected Both human trials applied GHK-Cu to the skin. No published trial has given it by injection, so nothing in the human evidence describes injected GHK-Cu. Sources ## Where every figure comes from 1. [GHK-Cu mechanism source](https://doi.org/10.1155/2015/648108) · checked 23 September 2026 2. [Wound Repair Regen 1994](https://doi.org/10.1046/j.1524-475x.1994.20406.x) · checked 23 September 2026 3. [Arch Facial Plast Surg 2006](https://doi.org/10.1001/archfaci.8.4.252) · checked 23 September 2026 4. [J Orthop Res 2015](https://doi.org/10.1002/jor.22831) · checked 23 September 2026 5. [Europe PMC search, GHK-Cu](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22GHK-Cu%22%20OR%20TITLE_ABS%3A%22copper%20tripeptide%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [GHK-Cu 50mg](https://www.primaralabs.com/marketplace/ghk-cu-50mg) - [GLOW Blend 70mg](https://www.primaralabs.com/marketplace/glow-blend-70mg) - [Evidence Map: GHK-Cu](https://www.primaralabs.com/research/evidence#ghk-cu) - [Is GHK-Cu FDA approved?](https://www.primaralabs.com/answers/is-ghk-cu-fda-approved) - [What is TB-500?](https://www.primaralabs.com/answers/what-is-tb-500) --- URL: https://www.primaralabs.com/answers/what-is-mots-c-studied-for Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-is-mots-c-studied-for.md # What is MOTS-c studied for? MOTS-c is a 16-amino-acid peptide encoded in mitochondrial DNA, studied in mice and cells for insulin resistance, diet-induced obesity, physical decline with age and autoimmune diabetes. As of 23 September 2026, no published study has given MOTS-c to people, so every finding below is from animals or cells. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## How it is thought to act MOTS-c is a 16-amino-acid peptide encoded in mitochondrial DNA. In mouse and cell studies it acts mainly on skeletal muscle, where it inhibits the folate cycle and linked purine synthesis, which activates the energy sensor AMPK. In people, exercise raises the body's own MOTS-c levels; it has not been given to people in a published study. 02 ## What the mouse studies found In mice, MOTS-c prevented insulin resistance linked to age and a high-fat diet, and prevented diet-induced obesity. In mice, MOTS-c treatment started late in life increased physical capacity. In non-obese diabetic mice, MOTS-c reduced the development of high blood sugar and immune-cell infiltration of pancreatic islets. 03 ## Human data No human adverse event data are published; the Research Desk's Europe PMC search on 23 September 2026 found none. The US FDA states it has not identified any human exposure data on products containing MOTS-c by any route. The evidence level is animal and cell. Studies that measure the body's own MOTS-c in blood, for example after exercise, are observational; they do not show what giving it does. 04 ## The papers behind it Animal and cell studies only. Cell Metab 2015: In mice, MOTS-c prevented insulin resistance linked to age and a high-fat diet, and prevented diet-induced obesity. Nat Commun 2021: In mice, MOTS-c treatment started late in life increased physical capacity. Cell Rep 2021: In non-obese diabetic mice, MOTS-c reduced high blood sugar and immune-cell infiltration of pancreatic islets. 05 ## What the evidence can and cannot say Because every result above comes from mice or cells, none of it establishes an effect in people, and the size of any effect in a person is unknown. Sources ## Where every figure comes from 1. [MOTS-c mechanism source](https://doi.org/10.1016/j.cmet.2015.02.009) · checked 23 September 2026 2. [Cell Metab 2015](https://doi.org/10.1016/j.cmet.2015.02.009) · checked 23 September 2026 3. [Nat Commun 2021](https://doi.org/10.1038/s41467-020-20790-0) · checked 23 September 2026 4. [Europe PMC search, MOTS-c](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22MOTS-c%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [MOTS-c 10mg](https://www.primaralabs.com/marketplace/mots-c-10mg) - [Evidence Map: MOTS-c](https://www.primaralabs.com/research/evidence#mots-c) - [Is MOTS-c FDA approved?](https://www.primaralabs.com/answers/is-mots-c-fda-approved) - [What does research show on NAD+ injections?](https://www.primaralabs.com/answers/what-does-research-show-on-nad-injections) --- URL: https://www.primaralabs.com/answers/what-does-research-show-on-nad-injections Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-does-research-show-on-nad-injections.md # What does research show on NAD+ injections? As of 23 September 2026, the human research on NAD+ given by injection or infusion is small. A single-centre randomised trial in ischaemic heart failure reported a modestly higher heart pumping fraction on NAD+, and short studies measured blood NAD levels. Infused NAD+ is cleared quickly, so how much reaches cells is unclear. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## What NAD+ is NAD+ is a coenzyme central to cellular energy metabolism and redox balance, and a cofactor for enzymes involved in DNA repair and metabolism. Its levels fall with age, which is the rationale researchers give for supplementation. When infused into people it is cleared from plasma quickly and broken down by NAD-consuming enzymes, so how much reaches cells intact is unclear. 02 ## Human studies In a single-centre randomised trial of 180 adults with heart failure from ischaemic heart disease, with no phase stated, ejection fraction at one month was 45.44% on NAD+ against 42.44% on placebo; differences in clinical events were not statistically significant. In a phase 0/1b randomised trial in healthy adults aged 45 to 75, an oral NAD+ formulation raised whole-blood NAD inside cells by 53% against placebo after five days; no clinical endpoint held up after correction for multiple testing. 03 ## Animal studies In pigs with a 90-minute coronary artery blockage, NAD+ given before blood flow was restored reduced heart muscle death and improved recovery of heart function compared with saline. This was in pigs. In mice with a temporary stroke, NAD+ reduced the size of the damaged area, brain swelling and neurological deficits. This was in mice. 04 ## Side effects reported In the 180-person heart-failure trial, one of 90 on NAD+ reported minor dizziness. In a retrospective review at a commercial clinic, all 6 people given intravenous NAD+ reported stomach cramping, diarrhoea, nausea, vomiting, a faster heart rate or chest pressure during the infusion. Sources ## Where every figure comes from 1. [Am J Cardiovasc Drugs 2026](https://doi.org/10.1007/s40256-025-00764-7) · checked 23 September 2026 2. [GeroScience 2026](https://doi.org/10.1007/s11357-026-02399-1) · checked 23 September 2026 3. [Am J Cardiovasc Drugs 2026](https://doi.org/10.1007/s40256-025-00764-7) · checked 23 September 2026 4. [Front Aging 2026](https://doi.org/10.3389/fragi.2026.1652582) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [NAD+ 1000mg](https://www.primaralabs.com/marketplace/nad-1000mg) - [Evidence Map: NAD+](https://www.primaralabs.com/research/evidence#nad) - [Is NAD+ FDA approved?](https://www.primaralabs.com/answers/is-nad-plus-fda-approved) - [What is MOTS-c studied for?](https://www.primaralabs.com/answers/what-is-mots-c-studied-for) --- URL: https://www.primaralabs.com/answers/what-did-tesamorelin-trials-find Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-did-tesamorelin-trials-find.md # What did the tesamorelin trials find? In its phase 3 trials, first reported in 2007, tesamorelin reduced visceral abdominal fat measured by CT against placebo in adults with HIV and excess abdominal fat. As of 23 September 2026, that is the basis of its one US approval; smaller trials studied liver fat and cognition. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## Phase 3 In Tesamorelin phase 3 (Falutz, NEJM 2007), a phase 3 trial of tesamorelin in adults with HIV and abdominal fat accumulation (86% men) (n=412), the visceral adipose tissue was -15.2% on 2 mg over 26 weeks, against +5.0% on placebo (Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3)). In a pooled analysis of the two 26-week phase 3 trials (806 adults with HIV and excess abdominal fat), triglycerides fell 37 mg per decilitre on tesamorelin and rose 6 mg per decilitre on placebo. 02 ## Other trials In a 12-month randomised, placebo-controlled trial of 61 people with HIV and fatty liver disease, with no phase stated, tesamorelin reduced liver fat fraction by an absolute 4.1 percentage points more than placebo. In a 20-week phase 2 trial of 152 adults aged 55 to 87, some with mild cognitive impairment, the intent-to-treat analysis showed a favourable effect on a cognitive composite, mainly executive function; two later trials in other groups did not show a significant effect. 03 ## Side effects reported The abstract reports that adverse events did not differ significantly between groups, but that more participants on tesamorelin withdrew because of an adverse event; it gives no rates. In a 20-week phase 2 trial in older adults, mild adverse events were reported by 68% on tesamorelin against 36% on placebo. In a 6-month trial of 50 people with HIV, fasting glucose rose 9 mg per decilitre on tesamorelin against 2 on placebo at 2 weeks; the difference was not significant at 6 months. 04 ## How it works Tesamorelin is a synthetic analogue of growth hormone-releasing factor (GHRH 1-44). It acts on the pituitary to increase basal and pulsatile growth hormone secretion, which in turn raises IGF-1. Sources ## Where every figure comes from 1. [Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3)](https://doi.org/10.1056/NEJMoa072375) · checked 23 September 2026 2. [Lancet HIV 2019](https://doi.org/10.1016/s2352-3018(19)30338-8) · checked 23 September 2026 3. [Arch Neurol 2012](https://doi.org/10.1001/archneurol.2012.1970) · checked 23 September 2026 4. [Arch Neurol 2012](https://doi.org/10.1001/archneurol.2012.1970) · checked 23 September 2026 5. [JAMA 2014](https://doi.org/10.1001/jama.2014.8334) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Tesamorelin 10mg](https://www.primaralabs.com/marketplace/tesamorelin-10mg) - [Tesamorelin phase 3 on the Trial Explorer](https://www.primaralabs.com/research/trials/tesamorelin-phase-3-2007) - [Is tesamorelin FDA approved?](https://www.primaralabs.com/answers/is-tesamorelin-fda-approved) - [What is CJC-1295 with ipamorelin?](https://www.primaralabs.com/answers/what-is-cjc-1295-ipamorelin) --- URL: https://www.primaralabs.com/answers/how-does-pt-141-work Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/how-does-pt-141-work.md # How does PT-141 work? PT-141 is bremelanotide, a synthetic peptide that activates melanocortin receptors, chiefly MC3R and MC4R, in the brain rather than acting on blood vessels. As of 23 September 2026, its main evidence is RECONNECT, two 24-week phase 3 trials in premenopausal women with hypoactive sexual desire disorder, where nausea was the most common adverse event. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## The receptors Bremelanotide is a synthetic peptide analogue of alpha-melanocyte-stimulating hormone that acts as an agonist at melanocortin receptors, chiefly MC3R and MC4R. Investigators link MC4R agonism to its effects on sexual desire; MC4R also regulates appetite, which is why it was studied for food intake. 02 ## What RECONNECT measured In RECONNECT (studies 301 and 302), a phase 3 trial of bremelanotide in premenopausal women with hypoactive sexual desire disorder (n=1,267), the FSFI desire domain score difference from placebo was +0.30 points on study 301, 1.75 mg and +0.42 points on study 302, 1.75 mg over 24 weeks (Kingsberg SA et al. Obstet Gynecol 2019 (RECONNECT)). In the same two phase 3 trials, distress related to low sexual desire (FSDS-DAO item 13) fell 0.37 and 0.29 points more than placebo. 03 ## Adverse events The most frequently reported adverse events were nausea in 40.0% on 1.75 mg, integrated phase 3 against 1.3% on placebo, flushing in 20.3% on 1.75 mg, integrated phase 3 against 1.3% on placebo, headache in 11.3% on 1.75 mg, integrated phase 3 against 1.9% on placebo and injection site reactions in 5.4% on 1.75 mg, integrated phase 3 against 0.5% on placebo (Safety profile across the clinical programme, J Womens Health 2022 (integrated double-blind phase 3, N=1,247)). The safety review reports nausea as the most common reason for stopping bremelanotide, without a rate. Across the development programme, focal skin darkening was rare at labelled use but occurred in more than a third of people given up to 16 consecutive daily doses, and small, transient blood pressure rises were seen on ambulatory monitoring. Sources ## Where every figure comes from 1. [Bremelanotide mechanism source](https://doi.org/10.1111/j.1743-6109.2006.00268.x) · checked 23 September 2026 2. [Kingsberg SA et al. Obstet Gynecol 2019 (RECONNECT)](https://doi.org/10.1097/AOG.0000000000003500) · checked 23 September 2026 3. [J Womens Health 2022](https://doi.org/10.1089/jwh.2021.0191) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [PT-141 10mg](https://www.primaralabs.com/marketplace/pt-141-10mg) - [RECONNECT on the Trial Explorer](https://www.primaralabs.com/research/trials/reconnect) - [Is PT-141 FDA approved?](https://www.primaralabs.com/answers/is-pt-141-fda-approved) - [Which peptides have phase 3 trials?](https://www.primaralabs.com/answers/which-peptides-have-phase-3-trials) --- URL: https://www.primaralabs.com/answers/what-is-cjc-1295-ipamorelin Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-is-cjc-1295-ipamorelin.md # What is CJC-1295 with ipamorelin? CJC-1295 with ipamorelin combines two growth hormone secretagogues: CJC-1295, an analogue of growth hormone-releasing hormone, and ipamorelin, which acts on the ghrelin receptor. As of 23 September 2026, each has small human studies of its own, but no published study has given the two together, so the combination itself is unstudied. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## CJC-1295 CJC-1295 is a modified analogue of growth hormone-releasing hormone (GHRH 1-29). The form studied in people carries a reactive group that binds to albumin in the blood, which extends its half-life to several days and gives sustained rises in growth hormone and IGF-1. In two small randomised, placebo-controlled trials in healthy adults aged 21 to 61, one injection of CJC-1295 (DAC form) raised mean growth hormone 2 to 10-fold for 6 days or more and IGF-1 1.5 to 3-fold for 9 to 11 days. 02 ## Ipamorelin Ipamorelin is a synthetic five-amino-acid growth hormone secretagogue that acts on the ghrelin receptor to release growth hormone from the pituitary. In animal pharmacology it released growth hormone without raising ACTH or cortisol, which is why its developers called it selective. In a phase 2 placebo-controlled trial of 117 patients after bowel resection, ipamorelin did not significantly shorten the time to a first tolerated solid meal (median 25.3 against 32.6 hours on placebo). 03 ## Safety data The two healthy-volunteer trials report no serious adverse reactions; per-event rates are not given in the abstract. In the phase 2 bowel-surgery trial, any treatment-emergent adverse event occurred in 87.5% on ipamorelin against 94.8% on placebo. The US FDA states on its compounding page that it has identified serious adverse events associated with CJC-1295, including increased heart rate and systemic vasodilatory reaction. 04 ## Ipamorelin in healthy volunteers In a dose-escalation study in healthy men without a placebo arm, ipamorelin produced a single growth hormone peak at every dose studied. In a non-randomised study of healthy men aged 20 to 40, one week after CJC-1295 trough growth hormone was 7.5-fold higher and IGF-1 45% higher, while the frequency and size of growth hormone pulses were unchanged. Sources ## Where every figure comes from 1. [CJC-1295 source](https://doi.org/10.1152/ajpendo.00201.2006) · checked 23 September 2026 2. [Int J Colorectal Dis 2014](https://doi.org/10.1007/s00384-014-2030-8) · checked 23 September 2026 3. [J Clin Endocrinol Metab 2006](https://doi.org/10.1210/jc.2005-1536) · checked 23 September 2026 4. [FDA, bulk drug substances that may present significant safety risks in compounding](https://www.fda.gov/drugs/human-drug-compounding/certain-bulk-drug-substances-use-compounding-may-present-significant-safety-risks) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [CJC-1295 / Ipamorelin 5mg + 5mg](https://www.primaralabs.com/marketplace/cjc-1295-ipamorelin-10mg) - [Evidence Map: CJC-1295](https://www.primaralabs.com/research/evidence#cjc-1295) - [Evidence Map: ipamorelin](https://www.primaralabs.com/research/evidence#ipamorelin) - [Are CJC-1295 and ipamorelin FDA approved?](https://www.primaralabs.com/answers/is-cjc-1295-ipamorelin-fda-approved) - [What did the tesamorelin trials find?](https://www.primaralabs.com/answers/what-did-tesamorelin-trials-find) --- URL: https://www.primaralabs.com/answers/what-is-semax-studied-for Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-is-semax-studied-for.md # What is semax studied for? Semax is a synthetic seven-amino-acid peptide derived from a fragment of the hormone ACTH, studied mainly in Russia for recovery after stroke and for brain function. As of 23 September 2026, its human studies are small and their randomisation is not confirmed in English abstracts, so the evidence is rated small human studies. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## What it is Semax is a synthetic seven-amino-acid peptide (Met-Glu-His-Phe-Pro-Gly-Pro) derived from a fragment of ACTH. In rats it binds specific sites in the basal forebrain and raises BDNF and its receptor trkB. No defined receptor target in people is reported. 02 ## Human studies In a Russian study of 110 patients in rehabilitation after ischaemic stroke, the groups given semax had higher blood BDNF and better improvement on the Barthel index than groups not given it; the abstract does not state how patients were allocated. In an open-label study of 27 patients with motor neuron disease, semax did not change clinical rating scales but improved total quality-of-life score. In 24 healthy volunteers, resting-state brain imaging showed a larger default mode network subcomponent within 20 minutes in the 14 given semax than in the 10 given placebo. 03 ## Animal work and safety data In rats, one dose of semax raised hippocampal BDNF protein 1.4-fold and activation of its receptor trkB 1.6-fold. This was in rats. No human adverse event data are published in the English-language abstracts the Research Desk searched on 23 September 2026. The US FDA lists semax on its compounding safety-risk page, citing no or limited safety information. 04 ## The papers behind it Small Russian human studies without confirmed randomisation, and rat work. Brain Res 2006: In rats, one dose of semax raised hippocampal BDNF protein and trkB activation. J Neurochem 2006: Semax bound specifically in rat basal forebrain membranes and raised BDNF there within 3 hours. Cell Mol Neurobiol 2010: After an induced stroke in rats, semax increased transcription of neurotrophins and their receptors. Sources ## Where every figure comes from 1. [Zh Nevrol Psikhiatr 2018](https://doi.org/10.17116/jnevro20181183261-68) · checked 23 September 2026 2. [Europe PMC 18379501](https://europepmc.org/article/MED/18379501) · checked 23 September 2026 3. [Bull Exp Biol Med 2018](https://doi.org/10.1007/s10517-018-4234-3) · checked 23 September 2026 4. [Europe PMC search, semax](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22semax%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Semax 10mg](https://www.primaralabs.com/marketplace/semax-10mg) - [Evidence Map: semax](https://www.primaralabs.com/research/evidence#semax) - [What is selank studied for?](https://www.primaralabs.com/answers/what-is-selank-studied-for) - [What is DSIP studied for?](https://www.primaralabs.com/answers/what-is-dsip-studied-for) --- URL: https://www.primaralabs.com/answers/what-is-selank-studied-for Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-is-selank-studied-for.md # What is selank studied for? Selank is a synthetic seven-amino-acid peptide studied in Russia for generalised anxiety and related conditions. As of 23 September 2026, its human studies compared it with a benzodiazepine or added it to one, without a placebo arm, and its proposed mechanisms come from laboratory work that human studies have not confirmed. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## What it is Selank is a synthetic seven-amino-acid peptide (Thr-Lys-Pro-Arg-Pro-Gly-Pro). Laboratory and rat studies propose two mechanisms, allosteric modulation of GABA receptors and inhibition of the enzymes that break down enkephalins. Neither has been confirmed in human pharmacology studies. 02 ## Human studies In a Russian comparative study of 62 patients with generalised anxiety disorder or neurasthenia, selank and medazepam had similar effects on anxiety rating scales; there was no placebo arm and the abstract does not state how patients were allocated. In a Russian study of 70 patients with anxiety-spectrum disorders, adding selank to phenazepam was reported to reduce phenazepam side effects compared with phenazepam alone; there was no placebo arm. 03 ## Laboratory work and safety data In receptor binding assays on brain cell membranes, selank acted as a positive allosteric modulator of GABA binding. In human plasma in the test tube, selank inhibited the breakdown of enkephalins in a dose-dependent way. No human adverse event data are published in the English-language abstracts searched on 23 September 2026; the US FDA says it lacks important safety information on selank acetate given to people. 04 ## The papers behind it Small Russian human studies without a placebo arm, and laboratory work. Protein Pept Lett 2018: In receptor binding work, selank acted as a positive allosteric modulator of GABA binding. Front Pharmacol 2016: In rat frontal cortex, selank changed the expression of 45 of 84 neurotransmission genes within an hour. Bull Exp Biol Med 2001: In human plasma in the test tube, selank inhibited the enzymes that break down enkephalins. Sources ## Where every figure comes from 1. [Europe PMC 18454096](https://europepmc.org/article/MED/18454096) · checked 23 September 2026 2. [Zh Nevrol Psikhiatr 2015](https://doi.org/10.17116/jnevro20151156133-40) · checked 23 September 2026 3. [Protein Pept Lett 2018](https://doi.org/10.2174/0929866525666180925144642) · checked 23 September 2026 4. [Europe PMC search, selank](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22selank%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Selank 10mg](https://www.primaralabs.com/marketplace/selank-10mg) - [Evidence Map: selank](https://www.primaralabs.com/research/evidence#selank) - [What is semax studied for?](https://www.primaralabs.com/answers/what-is-semax-studied-for) - [What is DSIP studied for?](https://www.primaralabs.com/answers/what-is-dsip-studied-for) --- URL: https://www.primaralabs.com/answers/what-is-dsip-studied-for Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-is-dsip-studied-for.md # What is DSIP studied for? DSIP, delta sleep-inducing peptide, is a nine-amino-acid peptide first isolated from rabbit blood and later studied in people for sleep and insomnia. As of 23 September 2026, the human studies are small and mixed: a controlled insomnia study found weak effects, and no gene or receptor for DSIP has been identified. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## What it is Delta sleep-inducing peptide is a nine-amino-acid peptide first isolated from rabbit blood in 1977. No gene, precursor protein or receptor for it has been identified, so its mechanism of action is unknown, and a 2006 review describes its link to sleep as poorly characterised. 02 ## Human studies In a 1992 placebo-controlled study of 16 people with chronic insomnia, sleep efficiency was higher and sleep onset shorter than on placebo, but the authors judged the effects weak and not of major therapeutic benefit. In a 1981 placebo-controlled crossover study of 6 healthy volunteers, total sleep time in the following 130 minutes rose by a median 59% compared with placebo. In a randomised crossover study of 11 healthy men, DSIP lowered blood ACTH-like activity for at least 3 hours with no change in cortisol; a 1995 placebo-controlled study found no effect on ACTH or cortisol. 03 ## Side effects reported In a small randomised study during anaesthesia, DSIP was associated with a higher heart rate and lighter anaesthetic depth than saline; the size of the change is not given in the abstract. An uncontrolled 1984 series of withdrawal patients reported headache in a few patients, without a rate. 04 ## The papers behind it Small human studies from 1981 to 2009 with mixed results, and rat work. Neurosci Behav Physiol 1998: In rats with restricted blood flow to the brain, DSIP reduced posture problems and deaths. Seizure 2005: In rats, DSIP and an analogue reduced the incidence and duration of induced seizures. Sources ## Where every figure comes from 1. [Neuropsychobiology 1992](https://doi.org/10.1159/000118919) · checked 23 September 2026 2. [Europe PMC 6895513](https://europepmc.org/article/MED/6895513) · checked 23 September 2026 3. [Eur J Anaesthesiol 2009](https://doi.org/10.1097/eja.0b013e32831c8644) · checked 23 September 2026 4. [Eur Neurol 1984](https://doi.org/10.1159/000115715) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [DSIP 10mg](https://www.primaralabs.com/marketplace/dsip-10mg) - [Evidence Map: DSIP](https://www.primaralabs.com/research/evidence#dsip) - [What is selank studied for?](https://www.primaralabs.com/answers/what-is-selank-studied-for) - [What is semax studied for?](https://www.primaralabs.com/answers/what-is-semax-studied-for) --- URL: https://www.primaralabs.com/answers/what-is-kpv-studied-for Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-is-kpv-studied-for.md # What is KPV studied for? KPV is the last three amino acids of alpha-melanocyte-stimulating hormone, studied in mice and rats for inflammatory bowel conditions, colitis-associated tumours and chemotherapy mouth ulcers. As of 23 September 2026, KPV has not been given to people in a published study, so all its evidence is animal and cell work. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## How it is thought to act KPV is the last three amino acids of alpha-melanocyte-stimulating hormone. In cell studies it enters intestinal and immune cells through the peptide transporter PepT1 and dampens NF-kB and MAP kinase inflammatory signalling. A mouse study found its anti-inflammatory effect is unlikely to act through melanocortin receptors. 02 ## Animal studies In mice with chemically induced colitis, KPV reduced colitis and inflammatory cytokine expression. In two mouse colitis models, KPV-treated mice recovered earlier and regained more body weight, with less inflammatory infiltrate. In mice with colitis-associated cancer, KPV prevented tumour formation; it had no effect in mice lacking the PepT1 transporter. In rats with chemotherapy-induced mouth ulcers, KPV in an adhesive gel improved food intake and body-weight recovery. 03 ## Human data No human adverse event data are published; the Research Desk's Europe PMC search on 23 September 2026 found none. The US FDA says it has not identified human exposure data on products containing KPV, and FDA Philippines has warned against one unregistered KPV vial product. 04 ## The papers behind it Animal and cell studies only; KPV has not been given to people in a published study. Gastroenterology 2008: In mice with chemically induced colitis, KPV reduced colitis and inflammatory cytokine expression. Inflamm Bowel Dis 2008: In two mouse colitis models, KPV-treated mice recovered earlier with less inflammatory infiltrate. J Pharmacol Exp Ther 2003: In mice with induced peritonitis, KPV reduced the inflammatory response. 05 ## At Primara Labs Primara Labs sells KPV only as a component of its KLOW blend. The blend itself has not been studied; each component's evidence is set out separately on the product page. Sources ## Where every figure comes from 1. [KPV mechanism source](https://doi.org/10.1053/j.gastro.2007.10.026) · checked 23 September 2026 2. [Gastroenterology 2008](https://doi.org/10.1053/j.gastro.2007.10.026) · checked 23 September 2026 3. [Cell Mol Gastroenterol Hepatol 2016](https://doi.org/10.1016/j.jcmgh.2016.01.006) · checked 23 September 2026 4. [Europe PMC search, KPV](https://www.ebi.ac.uk/europepmc/webservices/rest/search?query=%28TITLE_ABS%3A%22KPV%22%20OR%20TITLE_ABS%3A%22Lys-Pro-Val%22%29&resultType=core&format=json&pageSize=50) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [KLOW Blend 80mg](https://www.primaralabs.com/marketplace/klow-blend-80mg) - [Evidence Map: KPV](https://www.primaralabs.com/research/evidence#kpv) - [Is KPV approved in the Philippines?](https://www.primaralabs.com/answers/is-kpv-approved-in-the-philippines) - [What does GHK-Cu do in research?](https://www.primaralabs.com/answers/what-does-ghk-cu-do-in-research) --- URL: https://www.primaralabs.com/answers/which-peptides-have-phase-3-trials Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/which-peptides-have-phase-3-trials.md # Which peptides have phase 3 trials? Of the 16 compounds on the Primara Research Desk Evidence Map, 5 have at least one completed phase 3 human trial as of 23 September 2026: retatrutide, tirzepatide, semaglutide, tesamorelin, bremelanotide. The others rest on phase 2, small human studies, or animal and cell work. Primara Labs sells some of the compounds covered here. Every figure on this page links to its source and the date it was checked. Updated 23 September 2026 01 ## Phase 3 human evidence Retatrutide: obesity and overweight with a weight-related condition, type 2 diabetes, knee osteoarthritis pain, obstructive sleep apnoea, chronic low back pain, cardiovascular and renal outcomes, and fatty liver disease (MASLD). Tirzepatide: obesity and overweight, obesity with type 2 diabetes, maintenance of weight reduction, and comparison with semaglutide. Semaglutide: obesity and overweight, obesity with type 2 diabetes, maintenance of weight reduction, and cardiovascular outcomes in people with cardiovascular disease. Tesamorelin: excess visceral fat in people with HIV on antiretroviral therapy, fatty liver disease in HIV, abdominal obesity with reduced growth hormone secretion, and cognition in older adults. Bremelanotide: hypoactive sexual desire disorder in premenopausal women; earlier, sexual arousal disorder and erectile dysfunction; body weight in a phase 1 study. 02 ## Below phase 3 Phase 2 human: Ipamorelin. Small human studies: CJC-1295, Semax, Selank, DSIP, BPC-157, GHK-Cu, NAD+. Animal and cell: TB-500, KPV, MOTS-c. 03 ## What phase 3 means Phase 3 is the large trial stage that regulators rely on for approval: hundreds or thousands of participants, a control group, and a pre-specified main outcome. A phase 3 result is about the dose, population and duration the trial studied, and about the medicine that was studied. Adverse events from each trial sit beside its results on the Trial Explorer, and the Evidence Map shows the trial that sets each compound's level. 04 ## How many trials sit behind each Retatrutide: 5 completed randomised human trials counted (Trials in the Research Desk trials dataset). Tirzepatide: 5 completed randomised human trials counted (SURMOUNT obesity trials in the trials dataset; the wider literature, including diabetes trials, is larger). Semaglutide: 7 completed randomised human trials counted (STEP obesity trials and SELECT in the trials dataset; the wider literature, including diabetes trials, is larger). Tesamorelin: 10 completed randomised human trials counted (Completed human RCTs identified and screened in Europe PMC). Bremelanotide: 9 completed randomised human trials counted (Completed human RCTs identified and screened in Europe PMC). Sources ## Where every figure comes from 1. [Primara Research Desk, Evidence Map dataset](https://www.primaralabs.com/data/evidence.json) · checked 23 September 2026 2. [Eli Lilly, TRIUMPH-1 topline release, 21 May 2026](https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss) · checked 23 September 2026 3. [Jastreboff AM et al. N Engl J Med 2022 (SURMOUNT-1)](https://doi.org/10.1056/NEJMoa2206038) · checked 23 September 2026 4. [Wilding JPH et al. N Engl J Med 2021 (STEP 1)](https://doi.org/10.1056/NEJMoa2032183) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Evidence Map](https://www.primaralabs.com/research/evidence) - [Trial Explorer](https://www.primaralabs.com/research/trials) - [Which research peptides are FDA approved?](https://www.primaralabs.com/answers/which-research-peptides-are-fda-approved) - [What did the retatrutide trials find?](https://www.primaralabs.com/answers/what-did-retatrutide-trials-find) --- URL: https://www.primaralabs.com/answers/what-does-an-endotoxin-result-mean Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-does-an-endotoxin-result-mean.md # What does an endotoxin result on a peptide vial mean? An endotoxin result measures bacterial endotoxin, a fragment of bacterial cell walls, in endotoxin units (EU), usually per vial. As of 23 September 2026, it is one test among several: it says nothing about whether the vial holds the right compound, how much of it, or how pure it is. Compare results only in the same unit. Updated 23 September 2026 01 ## What endotoxin is and how it is measured Endotoxin is a fragment of the outer wall of certain bacteria. It remains after bacteria are killed or filtered out, so a sterile material can still carry it. Laboratories measure it with the LAL test and report it in endotoxin units (EU), a measure of biological activity rather than weight. An endotoxin test, usually the LAL assay, measures bacterial endotoxin in endotoxin units. It does not show identity, amount or purity. A sterility or microbial test checks for living bacteria and fungi. A sterile sample can still carry endotoxin, which is measured separately. 02 ## Reading a figure The pharmacopeial threshold used for parenteral materials is 5 EU per kilogram of body weight per hour. When comparing results between sellers, check the unit first. Per vial, per mg and per mL figures are not interchangeable. An example with its scope stated: Retatrutide batch RETA-4728-A is Janoshik-tested for bacterial endotoxin: 6.066 EU per vial, analysed 21 September 2026 (task 234146, key H2KI86I8GWB4). This report covers bacterial endotoxin only. It does not establish identity or purity. 03 ## Where an endotoxin test is offered ACS Peptide Testing Labs (ACS Laboratory) lists "Endotoxin testing" at US$175 to 350 (quoted); Janoshik Analytical lists "Endotoxin Analysis (additional service)" at US$180; Accumark Labs lists "Endotoxin (LAL)" at US$200, each per its own price page, read on 23 September 2026. An endotoxin test is normally ordered alongside an identity and purity test, not instead of one; a seller that publishes only an endotoxin report has published a report about endotoxin and nothing else. Sources ## Where every figure comes from 1. [Janoshik verification page, batch RETA-4728-A](https://verify.janoshik.com/tests/234146_H2KI86I8GWB4) · checked 23 September 2026 2. [Janoshik Analytical, price list](https://janoshik.com/c/peptides/) · checked 23 September 2026 3. [Accumark Labs, price list](https://accumarklabs.com/services/) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Retatrutide 15mg](https://www.primaralabs.com/marketplace/retatrutide) - [Batch reports](https://www.primaralabs.com/coa) - [COA Reader](https://www.primaralabs.com/tools/coa-reader) - [What is the difference between a purity test and an identity test?](https://www.primaralabs.com/answers/purity-vs-identity-testing) - [How much does it cost to test a peptide?](https://www.primaralabs.com/answers/how-much-does-it-cost-to-test-a-peptide) --- URL: https://www.primaralabs.com/answers/purity-vs-identity-testing Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/purity-vs-identity-testing.md # What is the difference between a purity test and an identity test? An identity test checks that a vial holds the compound named on the label; a purity test, usually by HPLC, measures what share of the detected material is that compound. As of 23 September 2026, laboratories sell them together because each is incomplete alone: a pure sample of the wrong peptide passes purity. Updated 23 September 2026 01 ## The two tests An identity test checks that the substance is the compound named. Mass spectrometry measures the molecule's mass directly; an HPLC identity check compares how long the sample takes to pass through a column against a reference standard, which is weaker evidence on its own. A purity result, usually by HPLC, is the share of the detected material that is the target compound. It does not by itself prove what that compound is, which is why purity is normally paired with an identity test. A quantity result states how much of the compound the vial holds, usually in milligrams. A vial can be pure and still hold less than its label says. 02 ## How laboratories bundle them Janoshik Analytical's single-compound analyses cover identity, purity and amount; for example "BPC-157 analysis" at US$215. Accepts samples from anywhere in the world, per its own site. Its only test labelled blind is the common GLP-1 blind test. Blend analyses measure identity and amount but not purity. Accumark Labs lists "Core Panel (Identity, Purity & Quantity)" at US$250. States US sample intake. Identity is by HPLC; LC-MS identity is listed as in development. No sample quantity is stated. 03 ## What to read on the report What the test covers: An endotoxin test says nothing about identity or purity; an identity test says nothing about endotoxin. Read the tests requested line. The figure and its unit: The result should match what the seller quotes, in the same unit. Per vial, per mg and per mL are not interchangeable. Sources ## Where every figure comes from 1. [Janoshik Analytical, price list](https://janoshik.com/c/peptides/) · checked 23 September 2026 2. [Accumark Labs, price list](https://accumarklabs.com/services/) · checked 23 September 2026 3. [Primara COA Reader, test explainers](https://www.primaralabs.com/tools/coa-reader) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [COA Reader](https://www.primaralabs.com/tools/coa-reader) - [Lab Test Planner](https://www.primaralabs.com/tools/lab-test-planner) - [What is a blind peptide test?](https://www.primaralabs.com/answers/what-is-a-blind-peptide-test) - [What does an endotoxin result on a peptide vial mean?](https://www.primaralabs.com/answers/what-does-an-endotoxin-result-mean) --- URL: https://www.primaralabs.com/answers/how-much-does-it-cost-to-test-a-peptide Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/how-much-does-it-cost-to-test-a-peptide.md # How much does it cost to test a peptide? As of 23 September 2026, laboratory price pages list an identity and purity test on one peptide from US$200, and an endotoxin test from US$175 (the low end of a quoted range), in US dollars. Janoshik Analytical accepts samples from anywhere, per its site; 3 of the other laboratories state US sample intake. Updated 23 September 2026 01 ## Identity and purity, cheapest listing per laboratory ILS Laboratories, "HPLC Panel": US$200; ~1 week. Janoshik Analytical, "BPC-157 analysis": US$215; Average turnaround time: 7 business days. Accumark Labs, "Core Panel (Identity, Purity & Quantity)": US$250; Standard results typically in 2 business days from sample receipt. | Typical turnaround time for standard analytical services is 48–72 hours after sample acceptance. Vanguard Laboratory, "Level 1 Silver": US$250; Turnaround depends on the selected tests and is confirmed by the laboratory. ACS Peptide Testing Labs (ACS Laboratory), "Third-party COA verification": US$300 to 600 (quoted); Turnaround is 9 to 11 business days at one price for every customer. 02 ## Endotoxin and sterility ACS Peptide Testing Labs (ACS Laboratory), "Endotoxin testing": US$175 to 350 (quoted). Janoshik Analytical, "Endotoxin Analysis (additional service)": US$180. Accumark Labs, "Endotoxin (LAL)": US$200. Vanguard Laboratory, "Sterility": US$150; 14-day minimum turnaround. Accumark Labs, "Sterility (PCR)": US$230. Janoshik Analytical, "Sterility Testing (additional service)": US$290; Average turnaround of this test is 14 days. 03 ## Before sending a sample Sample rules decide which laboratory is practical from the Philippines. Janoshik Analytical: Accepts samples from anywhere in the world, per its own site. Its only test labelled blind is the common GLP-1 blind test. Blend analyses measure identity and amount but not purity. Accumark Labs: States US sample intake. Identity is by HPLC; LC-MS identity is listed as in development. No sample quantity is stated. A buyer who tests a Primara vial can use the result under its guarantee: 60-day money-back guarantee: if an accredited independent laboratory reports that a vial is not the compound on the label, or reports purity below the certificate published for that product, the purchase price is refunded. 04 ## Sample requirements Janoshik Analytical, in its own words: "You will receive step-by-step shipping instructions. You can let us know the tracking and data for the report via the confirmation page of your order. | We accept samples globally from all over the world. You will receive detailed shipping, packaging and labaling instructions after you create and pay for your order." Accumark Labs, in its own words: "Select your tests online. Get a prepaid shipping label instantly. Use the label to overnight your sample to our US lab. | Clients are responsible for properly packaging and shipping samples to Accumark in accordance with all applicable laws and carrier requirements." ACS Peptide Testing Labs (ACS Laboratory), in its own words: "Request a quote at acslabtest.com/get-quote, package 100–500 µg of lyophilized peptide in a sealed labeled vial, ship overnight with ice packs to the ACS lab in Sun City Center, Florida, and receive your Certificate of Analysis electronically in 9–11 business days. We accept samples from all 50 US states, no in-person drop-off required." Sources ## Where every figure comes from 1. [Janoshik Analytical, price list](https://janoshik.com/c/peptides/) · checked 23 September 2026 2. [Accumark Labs, price list](https://accumarklabs.com/services/) · checked 23 September 2026 3. [ACS Peptide Testing Labs (ACS Laboratory), price list](https://acslabtest.com/peptide-testing-cost) · checked 23 September 2026 4. [ILS Laboratories, price list](https://ils-lab.com/services/peptide-testing/) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Lab Test Planner](https://www.primaralabs.com/tools/lab-test-planner) - [Lab tests dataset](https://www.primaralabs.com/data#lab-tests) - [What is the difference between a purity test and an identity test?](https://www.primaralabs.com/answers/purity-vs-identity-testing) - [What is a blind peptide test?](https://www.primaralabs.com/answers/what-is-a-blind-peptide-test) --- URL: https://www.primaralabs.com/answers/what-is-a-blind-peptide-test Last updated: 2026-09-23 Markdown: https://www.primaralabs.com/answers/what-is-a-blind-peptide-test.md # What is a blind peptide test? In a blind peptide test the laboratory is not told which compound the sample should be, and has to identify it from the data. As of 23 September 2026, that is stronger evidence of identity than a named-target test, which can only confirm or reject the compound it was told to look for. Updated 23 September 2026 01 ## Why blind is stronger In a blind test the laboratory is not told which compound to expect and has to identify it. That is stronger than a test that confirms a compound named in advance, because a named-target test can only say whether the expected compound is present. A named-target test answers a narrower question. If a vial labelled as one GLP-1 compound held a different one, a test told to look only for the labelled compound reports that it is absent; a blind test reports what is actually there. 02 ## Who offers it Janoshik Analytical: With blind testing, you do not need to tell us which of the three peptides you suspect to be in your vial. The test will identify the peptide, all the while accurately measuring it’s amount in the vial and peptide purity. Janoshik Analytical prices "Common GLP-1 peptide blind test (Semaglutide, Tirzepatide and Retatrutide)" at US$360. 03 ## Reading a blind result Compound: The sample name on the laboratory's record should be the compound on the vial, not a related one. Batch: The batch on the record should match the batch printed on the vial in hand. A report for another batch says nothing about this one. 04 ## When it matters most A blind test earns its price where compounds are easy to confuse or substitute: peptides sold under similar names, or a cheaper compound that could be passed off as a dearer one. For those, confirming the named compound is present is a weaker question than asking the laboratory what is there. Sources ## Where every figure comes from 1. [Janoshik Analytical, price list](https://janoshik.com/c/peptides/) · checked 23 September 2026 2. [Primara COA Reader](https://www.primaralabs.com/tools/coa-reader) · checked 23 September 2026 Last reviewed 23 September 2026 Read next ## Related pages - [Lab Test Planner](https://www.primaralabs.com/tools/lab-test-planner) - [COA Reader](https://www.primaralabs.com/tools/coa-reader) - [What is the difference between a purity test and an identity test?](https://www.primaralabs.com/answers/purity-vs-identity-testing) - [How much does it cost to test a peptide?](https://www.primaralabs.com/answers/how-much-does-it-cost-to-test-a-peptide)