18+ · Research use only
Tesamorelin 10mg, Philippines
Peptide studied in Phase 3 human trials. Lyophilized powder, stocked in Metro Manila. For laboratory research use only.
What it did in trials
- 15.2% less visceral fat, Phase 3
- 15.2% less visceral fat over 26 weeks in a Phase 3 trial in adults with HIV and abdominal fat1
Choose a pack
Pack price replaces the 10% off. One compound per pack.
Pack price replaces the standing 10% off; they don't stack. One compound per pack.
Check out once for the whole cart. Pay by QR, confirm on WhatsApp.
Add more compounds if you like, then check out once. You pay by QR on your order page and send the screenshot on WhatsApp.
In the Philippines
GCash · Maya · QR Ph bank transfer · InstaPay
From abroad
- International transfer
Wise · International bank transfer · Zelle · Crypto
Payment details are sent in the WhatsApp chat once your order is confirmed.
Order by 12 noon on a weekday for same-day Metro Manila
Includes water, syringes, pads · plain box
60-day money-back guaranteeTerms
Order by 12 noon on a weekday for same-day delivery in Metro Manila
Free courier nationwide · Luzon 1-2 days · Visayas 2-3 days · Mindanao 3-5 days
Everything to reconstitute is included
5 x 3ml water · 50 syringes · 50 pads · plain outer packaging
60-day money-back guarantee
If an accredited independent laboratory reports that this vial is not the compound on the label, we refund what you paid for it. Evidence within 60 calendar days of delivery; you do not send anything back. Terms
Updated 12 October 2026
- Human evidence
- Phase 3
- Manufacturing
- cGMP · ISO 9001 · ISO 13485
- Latest batch report
- Report pending
- Storage
- 2 to 8 °C sealed
Tesamorelin in the Philippines
Tesamorelin is a stabilised analog of growth hormone releasing hormone, specifically a trans-3-hexenoyl modification of GRF(1-44). The acyl group slows degradation by dipeptidyl peptidase-4, which is the difference between a research-usable compound and one that clears in minutes.
It has the most substantial regulatory trial record of any GHRH analog in this catalogue, with published work concentrated on visceral adipose tissue endpoints and on downstream IGF-1 signalling. Unlike a direct growth hormone, it acts on the pituitary and so the resulting secretion retains its pulsatile pattern, which is the mechanistic point most of the literature turns on.
Tesamorelin comes in a 10mg freeze-dried vial. Keep it refrigerated from the moment it arrives, and refrigerated again after it is mixed. Ordering is done by message, not a checkout form: open WhatsApp from this page, send the drafted order, and we confirm the total and timing. Ordered before 12 noon on a weekday, Metro Manila addresses receive the same day. Provincial orders reach Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5. The Tesamorelin guide covers how the compound was developed and what it was studied for.
Regulatory status
Tesamorelin. FDA Philippines: not established. US FDA: Approved for reduction of excess abdominal fat in HIV-infected adult patients with lipodystrophy. Checked 23 September 2026.
Sold for laboratory research only, not for human consumption. Primara Labs does not give medical advice or dosing guidance. Regulatory Status Tracker
Laboratory handling
Reconstitution reference
| BAC water added | Resulting concentration | Note |
|---|---|---|
| 1.0 ml | 10 mg/ml | Highest concentration, smallest volumes |
| 2.0 ml | 5 mg/ml | Common reference dilution |
Reconstitute with bacteriostatic water. Reference values are for laboratory preparation only. Other volumes: reconstitution calculator, prefilled for Tesamorelin 10mg.
Handling and storage
Sealed vials
Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light.
Primara Labs storage instructionAdding diluent
Add the diluent slowly down the inside wall of the vial rather than straight onto the powder.
Mixing
The US prescribing instructions for tesamorelin, a lyophilised peptide medicine, tell users to swirl the vial to mix the powder and liquid, and not to shake it.
Tesamorelin US instructions for use, DailyMed · checked 23 September 2026Appearance
The same instructions say not to use the solution if it is cloudy, discoloured or has particles in it.
Tesamorelin US instructions for use, DailyMed · checked 23 September 2026After the stopper is punctured
CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry.
CDC, Preventing Unsafe Injection Practices · checked 23 September 2026What it did in trials
- 15.2% less visceral fat over 26 weeks in a Phase 3 trial in adults with HIV and abdominal fat1
Sources for the trial highlights
- 1.Tesamorelin phase 3 (Falutz, NEJM 2007), 2007. Adults with HIV and abdominal fat accumulation (86% men).
Benefits studied
Visceral fat reduction
Phase 3 humanIn a 26-week phase 3 trial of 412 adults with HIV and abdominal fat accumulation, visceral fat measured by CT fell 15.2% on tesamorelin and rose 5.0% on placebo.
Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3) · checked 23 September 2026Triglyceride reduction
Phase 3 humanIn a pooled analysis of the two 26-week phase 3 trials (806 adults with HIV and excess abdominal fat), triglycerides fell 37 mg per decilitre on tesamorelin and rose 6 mg per decilitre on placebo.
Pooled phase 3 analysis, J Clin Endocrinol Metab 2010 · checked 23 September 2026Cognition in older adults
Phase 2 humanIn a 20-week phase 2 trial of 152 adults aged 55 to 87, some with mild cognitive impairment, the intent-to-treat analysis showed a favourable effect on a cognitive composite, mainly executive function; two later trials in other groups did not show a significant effect.
Arch Neurol 2012 · checked 23 September 2026Liver fat reduction
Small human studiesIn a 12-month randomised, placebo-controlled trial of 61 people with HIV and fatty liver disease, with no phase stated, tesamorelin reduced liver fat fraction by an absolute 4.1 percentage points more than placebo.
Lancet HIV 2019 · checked 23 September 2026
Side effects reported
The abstract reports that adverse events did not differ significantly between groups, but that more participants on tesamorelin withdrew because of an adverse event; it gives no rates.
Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3) · checked 23 September 2026In a 20-week phase 2 trial in older adults, mild adverse events were reported by 68% on tesamorelin against 36% on placebo.
Arch Neurol 2012 · checked 23 September 2026In a 6-month trial of 50 people with HIV, fasting glucose rose 9 mg per decilitre on tesamorelin against 2 on placebo at 2 weeks; the difference was not significant at 6 months.
JAMA 2014 · checked 23 September 2026Findings are described as the research reported them, with the level of evidence for each. They are not a claim about any vial sold here, which is supplied for laboratory research use only.
How it works
Tesamorelin is a synthetic analogue of growth hormone-releasing factor (GHRH 1-44). It acts on the pituitary to increase basal and pulsatile growth hormone secretion, which in turn raises IGF-1.
Targets: GHRH receptor (pituitary)
What the research shows
Tesamorelin, a synthetic analogue of growth hormone-releasing factor, has two completed phase 3 trials in adults with HIV and excess abdominal fat, published in 2007 and 2010. The Research Desk evidence pass identified ten completed human randomised controlled trials in all. A cognition result in older adults was not repeated in two later trials.
Phase 3 · 26 weeks
Tesamorelin phase 3 (Falutz, NEJM 2007)In Tesamorelin phase 3 (Falutz, NEJM 2007), a phase 3 trial of tesamorelin in adults with HIV and abdominal fat accumulation (86% men) (n=412), the visceral adipose tissue was -15.2% on 2 mg over 26 weeks, against +5.0% on placebo (Falutz J et al. N Engl J Med 2007 (tesamorelin phase 3)).
Tesamorelin phase 3 (Falutz, NEJM 2007): The abstract reports that adverse events did not differ significantly between groups, but that more participants on tesamorelin withdrew because of an adverse event; it gives no rates.
The first published batch report is retatrutide 20mg batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued.
- Type
- Growth hormone-releasing factor analogue
- Molecular formula
- C221H366N72O67S
- Molecular weight
- 5,136 g/mol
- CAS
- 218949-48-5
- PubChem
- CID 16137828
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, with an N-terminal trans-3-hexenoyl group
- Presentation
- Lyophilized powder, 10 mg / vial
- Vial size
- 10mg
- Catalogue code
- PRM-012
Frequently asked
Tesamorelin questions, answered
How much is Tesamorelin in the Philippines?
At Primara Labs, Tesamorelin 10mg is ₱3,390 for a single vial, ₱2,643 per vial in a 5 pack (₱13,215 total) and ₱2,076 per vial in a 10 pack (₱20,760 total). Prices are in pesos and the pack price is shown on the product page before you order.
Where can I buy Tesamorelin in the Philippines?
Primara Labs keeps Tesamorelin 10mg in stock in Metro Manila cold storage. Order on WhatsApp from the product page: the message is typed for you, and stock, the total and delivery are confirmed in the chat. There is no on-site checkout.
Do you deliver Tesamorelin to Cebu, Davao and the provinces?
Yes. Metro Manila: same day before 12 noon, Grab Express / Lalamove, ₱150; Luzon: 1 to 2 business days, J&T Express, ₱250; Visayas: 2 to 3 business days, J&T Express, ₱250; Mindanao: 3 to 5 business days, J&T Express, ₱300. Cebu is in the Visayas and Davao in Mindanao. Courier is free on orders over ₱10,000 anywhere in the Philippines. Below that, a Metro Manila rider is ₱150, J&T Express is ₱250 to Luzon and the Visayas and ₱300 to Mindanao.
Is Tesamorelin FDA approved in the Philippines?
Tesamorelin. FDA Philippines: not established. US FDA: Approved for reduction of excess abdominal fat in HIV-infected adult patients with lipodystrophy. Checked 23 September 2026. Primara Labs supplies it for research use only; it is not for human consumption.
Is Tesamorelin currently available?
It is in stock. Verified orders placed before noon dispatch the same day across Metro Manila, with courier delivery reaching Luzon in 1 to 2 business days, the Visayas in 2 to 3 and Mindanao in 3 to 5.
How does Tesamorelin differ from CJC-1295 with Ipamorelin?
Tesamorelin is a single GHRH analog. The CJC-1295 and Ipamorelin blend pairs a GHRH analog with a ghrelin receptor agonist, so it acts on two pathways rather than one. Both are studied at the pituitary rather than supplying growth hormone directly.
What is Tesamorelin studied for?
Tesamorelin, a synthetic analogue of growth hormone-releasing factor, has two completed phase 3 trials in adults with HIV and excess abdominal fat, published in 2007 and 2010. The Research Desk evidence pass identified ten completed human randomised controlled trials in all. A cognition result in older adults was not repeated in two later trials.
What side effects were reported for Tesamorelin?
The abstract reports that adverse events did not differ significantly between groups, but that more participants on tesamorelin withdrew because of an adverse event; it gives no rates. In a 20-week phase 2 trial in older adults, mild adverse events were reported by 68% on tesamorelin against 36% on placebo. In a 6-month trial of 50 people with HIV, fasting glucose rose 9 mg per decilitre on tesamorelin against 2 on placebo at 2 weeks; the difference was not significant at 6 months.
How should Tesamorelin be stored?
Store sealed lyophilised vials refrigerated at 2 to 8 °C, away from light. CDC guidance, citing USP chapter 797, is that a multi-dose vial once opened is dated and discarded within 28 days unless the manufacturer states another date, and never used past its original expiry.
Does Primara Labs publish lab reports for Tesamorelin?
The first published batch report is retatrutide 20mg batch RETA-4728-A, Janoshik-tested for bacterial endotoxin (key H2KI86I8GWB4), at primaralabs.com/coa. Reports for further compounds are published there per batch as they are issued.
Related compounds
Answers
Questions about Tesamorelin, answered
All compounds supplied by Primara Labs are for laboratory research use only and are not for human consumption, diagnostic or therapeutic use. Statements on this page describe published research and have not been evaluated by the Philippine FDA. See Research Use Only terms.